We have found 156 public records related to Josh Anderson in 35 states . Ethnicity of all people found is Swedish. Education levels of people we have found are: Completed Graduate School, Completed College and Completed High School. All people found speak English language. There are 29 business registration records connected with Josh Anderson in public records. The businesses are registered in 17 different states. Most of the businesses are registered in Florida state. The businesses are engaged in 12 different industries. Most of the businesses are engaged in Automotive Services, Parking and Repair (Automotive) industry. There are 13 profiles of government employees in our database. People found have seven different job titles. Most of them are employed as Fire/ems. These employees work in seven different states. Most of them work in Pennsylvania state. Average wage of employees is $39,969.
| Name / Names | Josh M Anderson |
|---|---|
| Age | 44 |
| Birth Date | 1980 |
| Person | 503 Richmond, Richmond, MO 64085 |
| Possible Relatives |
Frankie Caroline Haney Janice E Anderson Larry R Anderson Melissa R Anderson Casey Anderson M Anderson Joshua Marcus Anderson Effie Anderson Emery Anderson |
| Previous Address |
17 Chatham,Havelock, NC 28532 42038 Highway F,Richmond, MO 64085 704 Garner,Richmond, MO 64085 400 Beverly,Excelsior Springs, MO 64024 15 Henderson,Havelock, NC 28532 1309 Lake Maurer,Excelsior Springs, MO 64024 705 Caney,Dayton, TX 77535 2000 Jesse James,Excelsior Springs, MO 64024 4120 79th,Kansas City, MO 64151 208 Spring,Excelsior Springs, MO 64024 125 RR 3,Richmond, MO 64085 |
| Available |
| Name / Names | Josh Bob Anderson |
|---|---|
| Age | 47 |
| Birth Date | 1977 |
| Person | 1703 Maple, Lawton, OK 73507 |
| Possible Relatives |
Robert Leon Anderson Jackie R Anderson Jacquette R Anderson David W Anderson Carole Ann Anderson Sara Margaret Anderson |
| Previous Address |
1612 E,Lawton, OK 73501 1612 Sw,Lawton, OK 73501 |
| Name / Names | Josh M Anderson |
|---|---|
| Age | 49 |
| Birth Date | 1975 |
| Person | 5216 121st, Crown Point, IN 46307 |
| Possible Relatives |
John Leroy Anderson Ginger Kay Anderson Joshua M Anderson Pamela Anderson |
| Previous Address |
4 Scott,Hebron, IN 46341 8305 Randolph,Crown Point, IN 46307 5216 121st,Crown Point, IN 46307 |
| Name / Names | Josh D Anderson |
|---|---|
| Age | 57 |
| Birth Date | 1967 |
| Person | 14930 Uplands, North Bend, WA 98045 |
| Possible Relatives |
Betty T Anderson Denae Drake Anderson Roy W Anderson Molly Anderson Carmen A Thompsonanderson Denae Anderson Diane Anderson |
| Previous Address |
42017 149th,North Bend, WA 98045 10423 32nd,Bellevue, WA 98004 612 10th,Salt Lake City, UT 84103 3842 23rd,Seattle, WA 98106 1043 900,Salt Lake City, UT 84105 27228 142nd,Duvall, WA 98019 20405 108th,Redmond, WA 98053 207 7th,Salt Lake City, UT 84103 405 2nd,Salt Lake City, UT 84103 |
| Associated Business | ONE-TO-MANY LLC ONE-TO-MANY LLC ONE INTO MANY LLC ONE-TO-MANY LLC |
| Name / Names | Josh P Anderson |
|---|---|
| Age | 57 |
| Birth Date | 1967 |
| Person | 7126 Lydia, Woodbury, MN 55125 |
| Possible Relatives |
Jodi L Radziwill Renee L Rasmusson Irving Jl Anderson Tracey Glenda Giancola Joel Clayton Anderson Audrey E Anderson Tracy G Anderson Tracey G Anderson |
| Previous Address |
7126 Lydia,Saint Paul, MN 55125 1770 Reaney,Saint Paul, MN 55106 3550 Gershwin,Oakdale, MN 55128 3550 Gershwin,Saint Paul, MN 55128 1990 Radatz,Saint Paul, MN 55109 748 PO Box,Hudson, WI 54016 1701 Century,Saint Paul, MN 55125 |
| Associated Business | MINNESOTA EMPLOYERS INSURANCE SERVICES MINNESOTA EMPLOYERS INSURANCE SERVICES NO-HITTER SPORTSCARDS MIDWEST WHOLESALE MERCHANDISE COMPANY |
| Name / Names | Josh P Anderson |
|---|---|
| Age | 61 |
| Birth Date | 1963 |
| Person | 3132 Carroll, Cedar Rapids, IA 52403 |
| Possible Relatives |
Christine Marie Anderson Joshua P Anderson Joshua Paul Anderson Christine M Anderson |
| Previous Address |
32442 Safflower,Winchester, CA 92596 315 4th,Ottumwa, IA 52501 1 PO Box,Pulaski, IA 52584 301 Washington,Fairfield, IA 52556 305 Pirie,Hiawatha, IA 52233 77 PO Box,Bloomfield, IA 52537 |
| Available |
| Name / Names | Josh Randall Anderson |
|---|---|
| Age | 62 |
| Birth Date | 1962 |
| Person | 2 Mi Of Hwy 3, Broken Bow, OK 74728 |
| Phone Number | 580-420-3726 |
| Possible Relatives |
Donna Lynn Anderson Mackey J Anderson Warren D Anderson |
| Previous Address |
103 RR 3, Broken Bow, OK 74728 RR 3, Broken Bow, OK 74728 RR 5, Broken Bow, OK 74728 4 Mi Mi Of #1/4, Broken Bow, OK 74728 4 Mi W 1 4 Mi Of, Broken Bow, OK 74728 103 PO Box, Broken Bow, OK 74728 573 PO Box, Broken Bow, OK 74728 |
| Name / Names | Josh D Anderson |
|---|---|
| Age | 72 |
| Birth Date | 1952 |
| Person | 612 39th, Savannah, GA 31415 |
| Possible Relatives |
Melinda M Anderson Judy B Anderson Mary S Landerson Tonya D Anderson Rose Solomon Anderson Mary L Anderson |
| Previous Address |
629 37th,Savannah, GA 31415 629 38th,Savannah, GA 31401 2003 Bull,Savannah, GA 31401 |
| Name / Names | Josh Anderson |
|---|---|
| Age | 94 |
| Birth Date | 1929 |
| Person | 20759 County Road 153, Blair, OK 73526 |
| Possible Relatives |
Teresa Marie Anderson Joshua Caleb Anderson Teresa M Anderson |
| Previous Address |
RR 1, Blair, OK 73526 384 PO Box, Blair, OK 73526 Of City, Blair, OK 73526 167K PO Box, Blair, OK 73526 167K RR 1, Blair, OK 73526 |
| Name / Names | Josh Anderson |
|---|---|
| Age | 100 |
| Birth Date | 1923 |
| Person | 1456 Trezevant St, Memphis, TN 38108 |
| Phone Number | 901-458-7122 |
| Possible Relatives |
Ruby M Anderson Randy L Anderson Mary L Anderson Bessie L Anderson Djuan Anderson Octavious Anderson Stacey L Anderson Kizzy Marie Anderson K Anderson |
| Previous Address |
2844 Leafy Hollow Dr #1, Memphis, TN 38127 4569 Sunnybrook St, Memphis, TN 38127 4569 Sunny View Dr, Memphis, TN 38127 795 Stonewall St, Memphis, TN 38107 4569 Sunnybrook, Memphis, TN 37501 |
| Name / Names | Josh H Anderson |
|---|---|
| Age | N/A |
| Person | 809 Jean, Lebanon, IN 46052 |
| Possible Relatives |
Gregory J Anderson Denise D Anderson |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 2935 Cobb, Atlanta, GA 30339 |
| Possible Relatives |
Yvonne A Anderson Yvonne A Andersonward |
| Previous Address |
3852 McElroy,Doraville, GA 30340 2025 Lindsey,Decatur, GA 30035 |
| Name / Names | Josh L Anderson |
|---|---|
| Age | N/A |
| Person | 1004 Jefferson, Malvern, AR 72104 |
| Possible Relatives |
Joshua L Anderson Lezlee Rhea Anderson |
| Previous Address | 1201 Mill,Malvern, AR 72104 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 710 Rock, Eufaula, OK 74432 |
| Possible Relatives |
Rebecca Alane Anderson Ina B Anderson Gregory Allen Anderson Joshua Tyler Anderson Elizabeth Nichole Harjo Nicole Anderson Donna Michelle Mccormick |
| Previous Address | 420 Jefferson,Eufaula, OK 74432 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 419 Arbor Vista, Jackson, MS 39209 |
| Possible Relatives |
Robert E Anderson Susan R Anderson Martha Anderson Vincent Anderson |
| Name / Names | Josh R Anderson |
|---|---|
| Age | N/A |
| Person | 400 Beckman, Mckeesport, PA 15132 |
| Possible Relatives |
Shelby A Anderson Raymond J Anderson Adam R Anderson Joshua R Anderson Daniel W Anderson |
| Name / Names | Josh E Anderson |
|---|---|
| Age | N/A |
| Person | 257 Cribbon, Cheyenne, WY 82007 |
| Possible Relatives |
Veronica Anderson Verinoca Anderson |
| Name / Names | Josh L Anderson |
|---|---|
| Age | N/A |
| Person | 1395 R, Springfield, OR 97477 |
| Available |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 832944 PO Box, Richardson, TX 75083 |
| Possible Relatives |
Joan Anderson Frank Joann Fiorillo Anderson |
| Previous Address |
2944 PO Box, Richardson, TX 75083 401 Lowell Ln, Richardson, TX 75080 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 8906 GEE ST, JUNEAU, AK 99801 |
| Phone Number | 907-789-5410 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 171 ANDERSON GOLDMAN RD, CHATOM, AL 36518 |
| Phone Number | 251-847-2127 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 501 GLENWOOD AVE, GREEN FOREST, AR 72638 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | PO BOX 1457, CHINO VALLEY, AZ 86323 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 3663 E BERMUDA ST UNIT 1110, TUCSON, AZ 85716 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | PO BOX 2283, MESA, AZ 85214 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 2421 COUNTY ROAD 116, FORT PAYNE, AL 35968 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | PO BOX 612, HOLLYWOOD, AL 35752 |
| Name / Names | Josh R Anderson |
|---|---|
| Age | N/A |
| Person | 500 7th, Williamsport, PA 17701 |
| Name / Names | Josh J Anderson |
|---|---|
| Age | N/A |
| Person | 519 DESOTO RD, BUTLER, AL 36904 |
| Phone Number | 205-459-4169 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 571 PO Box, Fort Pierre, SD 57532 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 745 ELDORADO BLVD APT 2331, BROOMFIELD, CO 80021 |
| Phone Number | 303-460-3987 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 14161 E JEWELL AVE BLDG 7, AURORA, CO 80012 |
| Phone Number | 303-751-0617 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 2727 E VISTA DR, PHOENIX, AZ 85032 |
| Phone Number | 602-626-7755 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 235 E RAY RD BLDG 14, CHANDLER, AZ 85225 |
| Phone Number | 480-782-8357 |
| Name / Names | Josh A Anderson |
|---|---|
| Age | N/A |
| Person | 10603 W ALICE AVE, PEORIA, AZ 85345 |
| Phone Number | 623-876-0475 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 1670 E FRANQUERO LN, COTTONWOOD, AZ 86326 |
| Phone Number | 928-634-2554 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | 6035 SAILING CT, COLORADO SPGS, CO 80918 |
| Phone Number | 719-597-8321 |
| Name / Names | Josh Anderson |
|---|---|
| Age | N/A |
| Person | PO BOX 344, AUSTIN, AR 72007 |
| Business Name | Telephony Supply Inc |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | FL |
| Address | 9051 Fla Min Blvd Ste 103 Tampa FL 33634 |
| Industry | Electrical, Electronic and Components other than Computer Equipment (Equipment) |
| SIC Code | 3661 |
| SIC Description | Telephone And Telegraph Apparatus |
| Phone Number | 813-769-2320 |
| Business Name | TPLLC GA, Inc. |
|---|---|
| Person Name | Josh Anderson |
| Position | registered agent |
| State | FL |
| Address | 320 W. Kennedy Blvd. Suite 650, Tampa, FL 33606 |
| Business Contact Type | Secretary |
| Model Type | Corp |
| Locale | Domestic |
| Qualifier | ForProfit |
| Effective Date | 2013-01-14 |
| Entity Status | Active/Compliance |
| Type | Secretary |
| Business Name | Rite Aid Pharmacy |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | IN |
| Address | 601 S Main St Salem IN 47167-1057 |
| Industry | Miscellaneous Retail (Stores) |
| SIC Code | 5912 |
| SIC Description | Drug Stores And Proprietary Stores |
| Phone Number | 812-883-1023 |
| Number Of Employees | 16 |
| Annual Revenue | 2283840 |
| Fax Number | 812-883-1869 |
| Business Name | Pizza Hut |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | ID |
| Address | 1733 Addison Ave E Twin Falls ID 83301-5302 |
| Industry | Eating and Drinking Establishments (Food) |
| SIC Code | 5812 |
| SIC Description | Eating Places |
| Phone Number | 208-734-6170 |
| [email protected] | |
| Number Of Employees | 22 |
| Annual Revenue | 970000 |
| Website | www.pizzahut.com |
| Business Name | New Frontier Bank |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | CO |
| Address | 2425 35th Ave, Greeley, CO 80634-4173 |
| Phone Number | |
| [email protected] | |
| Title | Assistant Vice President and Lender |
| Business Name | Landscape Doctors & Concrete |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | VA |
| Address | 1410 Colchester Rd Woodbridge VA 22191-2948 |
| Industry | Construction - Special Trade Contractors |
| SIC Code | 1771 |
| SIC Description | Concrete Work |
| Phone Number | 703-491-3627 |
| Number Of Employees | 2 |
| Annual Revenue | 247680 |
| Business Name | Killdeer Mountain Contracting |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | ND |
| Address | 196 109th Ave NW Killdeer ND 58640-9119 |
| Industry | Building Construction - Operative Builders and General Contractors (Construction) |
| SIC Code | 1522 |
| SIC Description | Residential Construction, Nec |
| Phone Number | 701-764-6245 |
| Business Name | Josh Anderson |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | IA |
| Address | 301 E. Washington, Fairfield, IA 52556 |
| SIC Code | 737911 |
| Phone Number | 515-472-5267 |
| [email protected] |
| Business Name | Josh Anderson |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | FL |
| Address | 1527 W. Carmen St., Tampa, FL 33606 |
| SIC Code | 874104 |
| Phone Number | |
| [email protected] |
| Business Name | International Fight League, Inc. |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | NY |
| Address | 424 W 33 rd St Ste 650, New York, NY 10001 |
| Phone Number | |
| [email protected] | |
| Title | CIO |
| Business Name | Home Accents |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | NC |
| Address | P.O. BOX 160 Greensboro NC 27402-0160 |
| Industry | Wholesale Trade - Durable Goods (Products) |
| SIC Code | 5099 |
| SIC Description | Durable Goods, Nec |
| Phone Number | 336-294-1002 |
| Business Name | Hamilton Place Mall Cinema 9 |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | TN |
| Address | 2100 Hamilton Place Blvd Chattanooga TN 37421-6006 |
| Industry | Motion Pictures (Entertainment) |
| SIC Code | 7832 |
| SIC Description | Motion Picture Theaters, Except Drive-In |
| Phone Number | 423-899-5522 |
| Business Name | Genetic ID |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | IA |
| Address | 1760 Observatory Drive, Fairfield, IA 52556 |
| SIC Code | 599402 |
| Phone Number | 515-472-5267 |
| [email protected] |
| Business Name | Frier Manufactured Home Model |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | FL |
| Address | 2101 NW 11th Dr Chiefland FL 32626-1924 |
| Industry | Mobile Home Dealers, Garden Supply, Building Materials and Hardware (Construction) |
| SIC Code | 5271 |
| SIC Description | Mobile Home Dealers |
| Phone Number | 352-490-6100 |
| Number Of Employees | 4 |
| Annual Revenue | 1689520 |
| Business Name | Frank Englich Custom Boots |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | MT |
| Address | 3505 Fallon St APT 21b Bozeman MT 59718-1948 |
| Industry | Wholesale Trade - Non-Durable Goods (Products) |
| SIC Code | 5139 |
| SIC Description | Footwear |
| Phone Number | 406-522-0761 |
| Business Name | Ellison Enterprises LTD |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | GA |
| Address | 402 W 3rd St SW Rome GA 30165-2805 |
| Industry | Business Services (Services) |
| SIC Code | 7319 |
| SIC Description | Advertising, Nec |
| Phone Number | 706-290-0171 |
| Number Of Employees | 3 |
| Annual Revenue | 296640 |
| Fax Number | 706-234-6949 |
| Business Name | Darrell A Hancock |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | FL |
| Address | 1527 W. Carmen St, Tampa, FL 33605 |
| Phone Number | |
| [email protected] | |
| Title | CEO |
| Business Name | Commercial Carolina |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | NC |
| Address | 6000 Fairview Road, St. 310, Charlotte, NC 28211 |
| Phone Number | |
| [email protected] | |
| Title | Assistant Vice President-Charlotte Office |
| Business Name | Casey's Carry Out Pizza |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | MO |
| Address | 402 Highway 28 W Belle MO 65013-2400 |
| Industry | Eating and Drinking Establishments (Food) |
| SIC Code | 5812 |
| SIC Description | Eating Places |
| Phone Number | 573-859-6879 |
| Number Of Employees | 11 |
| Annual Revenue | 404000 |
| Business Name | COMPACTDATA,INC. |
|---|---|
| Person Name | JOSH ANDERSON |
| Position | company contact |
| State | FL |
| Address | 1527 W CARMEN ST, TAMPA, FL 33606 |
| SIC Code | 9999 |
| Phone Number | 813-251-2345 |
| [email protected] |
| Business Name | BLACK INK INTERNATIONAL, INC. |
|---|---|
| Person Name | JOSH ANDERSON |
| Position | President |
| State | NV |
| Address | 564 WEDGE LANE 564 WEDGE LANE, FERNLEY, NV 89408 |
| Inactive | F |
| Terminated | F |
| Resigned | F |
| Corporation Type | Domestic Corporation |
| Corporation Status | Default |
| Corporation Number | E0373492012-5 |
| Creation Date | 2012-07-16 |
| Type | Domestic Corporation |
| Business Name | Automatic Auto Financing Inc |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | AR |
| Address | PO Box 765 Springdale AR 72765-0765 |
| Industry | Gasoline Service Stations and Automotive Dealers (Automotive) |
| SIC Code | 5511 |
| SIC Description | New And Used Car Dealers |
| Phone Number | 479-986-9800 |
| Number Of Employees | 9 |
| Annual Revenue | 4146780 |
| Fax Number | 479-986-9900 |
| Business Name | Anderson Truck & Auto Repair |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | PA |
| Address | 5363 Lincoln Hwy Gap PA 17527-9701 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7538 |
| SIC Description | General Automotive Repair Shops |
| Fax Number | 717-442-8278 |
| Business Name | Anderson Truck & Auto |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | PA |
| Address | 5363 Lincoln Hwy Gap PA 17527-9701 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7538 |
| SIC Description | General Automotive Repair Shops |
| Phone Number | 717-442-8278 |
| Number Of Employees | 3 |
| Annual Revenue | 669300 |
| Fax Number | 717-442-8851 |
| Business Name | Advantage Marketing Solutions |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | GA |
| Address | P.O. BOX 446 Kingston GA 30145-0446 |
| Industry | Wholesale Trade - Durable Goods (Products) |
| SIC Code | 5084 |
| SIC Description | Industrial Machinery And Equipment |
| Phone Number | 706-378-7979 |
| Person Name | JOSH ANDERSON |
|---|---|
| Filing Number | 800889164 |
| Position | DIRECTOR |
| State | TX |
| Address | 330 N 8TH STREET, STE 100, MIDLOTHIAN TX 76065 |
| Person Name | JOSH ANDERSON |
|---|---|
| Filing Number | 800889164 |
| Position | SECRETARY |
| State | TX |
| Address | 330 N 8TH STREET, STE 100, MIDLOTHIAN TX 76065 |
| Person Name | Josh Anderson |
|---|---|
| Filing Number | 800801043 |
| Position | Director |
| State | TX |
| Address | 330 N 8th St Ste 100, Midlothian TX 76065 |
| Person Name | Josh Anderson |
|---|---|
| Filing Number | 800801043 |
| Position | Secretary |
| State | TX |
| Address | 330 N 8th St Ste 100, Midlothian TX 76065 |
| State | WY |
|---|---|
| Calendar Year | 2016 |
| Employer | Uinta County 1 Board Of Cooperative Educational Services |
| Job Title | Temp-instructor |
| Name | Anderson Josh |
| Annual Wage | $1,425 |
| State | UT |
|---|---|
| Calendar Year | 2017 |
| Employer | Univeristy Of Utah |
| Job Title | Manager Health Information |
| Name | Anderson Josh W |
| Annual Wage | $87,940 |
| State | TN |
|---|---|
| Calendar Year | 2018 |
| Employer | County Of Morgan |
| Name | Anderson Josh |
| Annual Wage | $21,099 |
| State | PA |
|---|---|
| Calendar Year | 2018 |
| Employer | Universal Audenried Charter School |
| Job Title | Assistant Or Vice Secondary Principal |
| Name | Anderson Josh |
| Annual Wage | $90,900 |
| State | PA |
|---|---|
| Calendar Year | 2017 |
| Employer | Universal Audenried Charter School |
| Job Title | School Administrator |
| Name | Anderson Josh |
| Annual Wage | $90,000 |
| State | PA |
|---|---|
| Calendar Year | 2016 |
| Employer | Universal Audenried Charter School |
| Job Title | Supervisor / Coordinator |
| Name | Anderson Josh |
| Annual Wage | $69,999 |
| State | PA |
|---|---|
| Calendar Year | 2015 |
| Employer | Universal Audenried Charter School |
| Job Title | Secondary Teacher |
| Name | Anderson Josh |
| Annual Wage | $54,979 |
| State | OH |
|---|---|
| Calendar Year | 2017 |
| Employer | Village of Payne |
| Name | Anderson Josh |
| Annual Wage | $1,718 |
| State | OH |
|---|---|
| Calendar Year | 2016 |
| Employer | Village Of Payne |
| Name | Anderson Josh |
| Annual Wage | $1,882 |
| State | OH |
|---|---|
| Calendar Year | 2015 |
| Employer | Village Of Payne |
| Job Title | Fire/ems |
| Name | Anderson Josh |
| Annual Wage | $2,280 |
| State | ND |
|---|---|
| Calendar Year | 2018 |
| Employer | County Of Adams |
| Name | Anderson Josh R |
| Annual Wage | $47,732 |
| State | ND |
|---|---|
| Calendar Year | 2017 |
| Employer | County of Adams |
| Name | Anderson Josh R |
| Annual Wage | $48,573 |
| State | NE |
|---|---|
| Calendar Year | 2017 |
| Employer | City Of Holdrege |
| Name | Anderson Josh |
| Annual Wage | $1,064 |
| Name | Josh Anderson |
|---|---|
| Address | 702 SW 5th St Brainerd MN 56401-3997 -2509 |
| Phone Number | 218-251-7771 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $10,000 |
| Estimated Net Worth | $10,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 619 Hayes St Eveleth MN 55734-1621 -1621 |
| Phone Number | 218-744-1580 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $0 |
| Estimated Net Worth | $1 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 8654 Granite Ln Iron MN 55751 -8259 |
| Phone Number | 218-750-2747 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $75,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 47994 State 92 Clearbrook MN 56634 -4399 |
| Phone Number | 218-776-2375 |
| Gender | Male |
| Date Of Birth | 1979-01-21 |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $1 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 9020 Paseo De Valencia St Fort Myers FL 33908 -9663 |
| Phone Number | 239-405-0149 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $25,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 3600 W Saint Germain St Saint Cloud MN 56301-4633 APT 258-4645 |
| Phone Number | 320-685-5304 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $35,000 |
| Estimated Net Worth | $25,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 3700 SW 29th Ter Gainesville FL 32608-7651 APT B-3171 |
| Phone Number | 352-336-5886 |
| Telephone Number | 352-246-4668 |
| Mobile Phone | 352-246-4668 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $25,000 |
| Estimated Net Worth | $1 |
| Range Of New Credit | 3001 |
| Education | Completed High School |
| Language | English |
| Name | Josh D Anderson |
|---|---|
| Address | 10176 County Road 252 Live Oak FL 32060 -6864 |
| Phone Number | 386-244-0128 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1986-04-06 |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $20,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 5 |
| Range Of New Credit | 3001 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 1419 S Garrison Ave Carthage MO 64836 -2748 |
| Phone Number | 417-358-4630 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 2 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 24775 375th St Joice IA 50446-7505 -7505 |
| Phone Number | 515-320-2881 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh R Anderson |
|---|---|
| Address | 1883 Chestnut St Holt MI 48842 -1637 |
| Phone Number | 517-694-9105 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $45,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 3001 |
| Education | Completed College |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 1316 Three Rivers Dr O Fallon IL 62269 -7339 |
| Phone Number | 618-628-3173 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $100,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 17564 900 Rd Altoona KS 66710 -8614 |
| Phone Number | 620-325-5344 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Josh M Anderson |
|---|---|
| Address | 3842 Grove Rd Oswego IL 60543 -9289 |
| Phone Number | 630-935-1724 |
| Telephone Number | 630-551-0211 |
| Mobile Phone | 630-935-1734 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $65,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed Graduate School |
| Language | English |
| Name | Josh P Anderson |
|---|---|
| Address | 7126 Lydia Ln Saint Paul MN 55125 -6704 |
| Phone Number | 651-739-2291 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1964-06-20 |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $100,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 310 Rodney Nix Rd Cleveland GA 30528 -4767 |
| Phone Number | 706-348-1250 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $40,000 |
| Estimated Net Worth | $100,000 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 6035 Sailing Ct Colorado Springs CO 80918 -4882 |
| Phone Number | 719-355-5642 |
| Gender | Male |
| Date Of Birth | 1976-08-27 |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $65,000 |
| Estimated Net Worth | $1 |
| Lines Of Credit Trade Counter | 2 |
| Education | Completed High School |
| Language | English |
| Name | Josh M Anderson |
|---|---|
| Address | 707 Paradise Ln Colorado Springs CO 80904 -1739 |
| Phone Number | 719-623-9514 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $20,000 |
| Estimated Net Worth | $1 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 8205 Long Lake Rd Saint Paul MN 55112 -4623 |
| Phone Number | 763-234-5209 |
| Mobile Phone | 763-234-7465 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 2 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 512 Trees Of Kennesaw Pkwy Nw Kennesaw GA 30152 -7644 |
| Phone Number | 770-380-6417 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $25,000 |
| Estimated Net Worth | $250,000 |
| Range Of New Credit | 5001 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | Po Box 9355 Highland IN 46322 -9355 |
| Phone Number | 773-329-7937 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $10,000 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Josh N Anderson |
|---|---|
| Address | 12943 W 550 S Sandborn IN 47578 -5325 |
| Phone Number | 812-694-8815 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed High School |
| Language | English |
| Name | Josh D Anderson |
|---|---|
| Address | 612 W 39th St Savannah GA 31415 -8447 |
| Phone Number | 912-220-3893 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $30,000 |
| Estimated Net Worth | $50,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | 18 Friar Tuck Dr Savannah GA 31406 -3002 |
| Phone Number | 912-480-8575 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $25,000 |
| Estimated Net Worth | $10,000 |
| Range Of New Credit | 5001 |
| Education | Completed High School |
| Language | English |
| Name | Josh Anderson |
|---|---|
| Address | PO Box 2475 Saint Johns AZ 85936-2475 -2475 |
| Phone Number | 928-337-9384 |
| Gender | Male |
| Ethnicity | Swedish |
| Ethnic Group | Scandinavian |
| Estimated Household Income | $35,000 |
| Estimated Net Worth | $25,000 |
| Education | Completed High School |
| Language | English |
| Name | ANDERSON, JOSH |
|---|---|
| Amount | 250.00 |
| To | Barack Obama (D) |
| Year | 2008 |
| Transaction Type | 15 |
| Filing ID | 28932606960 |
| Application Date | 2008-07-14 |
| Contributor Occupation | Political Coordinator |
| Contributor Employer | Afscme Council 18 |
| Organization Name | AFSCME Council 18 |
| Contributor Gender | M |
| Recipient Party | D |
| Committee Name | Obama for America |
| Seat | federal:president |
| Address | 507 Pinon Creek Rd SE ALBUQUERQUE NM |
| Name | ANDERSON, JOSH |
|---|---|
| Amount | 100.00 |
| To | SUTHERLAND, DOUG |
| Year | 20008 |
| Application Date | 2008-07-24 |
| Recipient Party | R |
| Recipient State | WA |
| Seat | state:office |
| Address | 645 E 2ND AVE COLVILLE WA |
| Name | ANDERSON, JOSH |
|---|---|
| Amount | 50.00 |
| To | KELTON, STEPHANIE |
| Year | 20008 |
| Application Date | 2008-09-18 |
| Recipient Party | D |
| Recipient State | KS |
| Seat | state:lower |
| Address | 11916 109TH ST OVERLAND PARK KS |
| Name | JOSH T/TANYA M S ANDERSON |
|---|---|
| Address | 94-1009 Mawaho Street Waipahu HI |
| Value | 285700 |
| Landarea | 3,809 square feet |
| Name | JOSH T ANDERSON |
|---|---|
| Address | 616 Walnut Street Columbia PA 17512 |
| Value | 13800 |
| Landvalue | 13800 |
| Name | JOSH R ANDERSON & COREY O ANDERSON |
|---|---|
| Address | 211 Kirkland Avenue #309 Kirkland WA 98033 |
| Value | 191400 |
| Landvalue | 28600 |
| Buildingvalue | 191400 |
| Name | JOSH D ANDERSON & DENAE D ANDERSON |
|---|---|
| Address | 42017 SE 149th Place North Bend WA 98045 |
| Value | 380000 |
| Landvalue | 282000 |
| Buildingvalue | 380000 |
| Name | ANDERSON JOSH |
|---|---|
| Address | 511 Se Bennie Lane Lake FL |
| Value | 16590 |
| Landvalue | 16590 |
| Buildingvalue | 29759 |
| Landarea | 43,560 square feet |
| Type | Residential Property |
| Name | ANDERSON JOSH A |
|---|---|
| Physical Address | 18552 MARCO BLVD, FORT MYERS, FL 33967 |
| Owner Address | 18552 MARCO BLVD, FORT MYERS, FL 33967 |
| Ass Value Homestead | 43710 |
| Just Value Homestead | 65803 |
| County | Lee |
| Year Built | 1982 |
| Area | 1811 |
| Applicant Status | Husband |
| Co Applicant Status | Wife |
| Land Code | Single Family |
| Address | 18552 MARCO BLVD, FORT MYERS, FL 33967 |
| Name | ANDERSON JOSH & LOREN |
|---|---|
| Physical Address | 2133 BRIARCLIFF CIR, MOUNT DORA FL, FL 32757 |
| Ass Value Homestead | 116613 |
| Just Value Homestead | 116613 |
| County | Lake |
| Year Built | 2008 |
| Area | 1788 |
| Applicant Status | Husband |
| Co Applicant Status | Wife |
| Land Code | Single Family |
| Address | 2133 BRIARCLIFF CIR, MOUNT DORA FL, FL 32757 |
| Name | ANDERSON JOSH |
|---|---|
| Physical Address | 9326 HUNTINGTON PARK WY, TAMPA, FL 33647 |
| Owner Address | 9326 HUNTINGTON PARK WAY, TAMPA, FL 33647 |
| Ass Value Homestead | 143144 |
| Just Value Homestead | 154112 |
| County | Hillsborough |
| Year Built | 1997 |
| Area | 2090 |
| Applicant Status | Other (Examples: single, joint tenants ? not |
| Co Applicant Status | Other (Examples: single, joint tenants ? not |
| Land Code | Single Family |
| Address | 9326 HUNTINGTON PARK WY, TAMPA, FL 33647 |
| Name | ANDERSON JOSH |
|---|---|
| Physical Address | 511 BENNIE LN SE, LAKE CITY, FL |
| Owner Address | 312 SW PILOTS WAY, LAKE CITY, FL 32024 |
| County | Columbia |
| Year Built | 2002 |
| Area | 1248 |
| Land Code | Mobile Homes |
| Address | 511 BENNIE LN SE, LAKE CITY, FL |
| Name | JOSH ANDERSON |
|---|---|
| Type | Voter |
| State | FL |
| Address | 150 CESSNA ST, SANTA ROSA BEACH, FL 32459 |
| Phone Number | 850-267-3618 |
| Email Address | [email protected] |
| Name | JOSH ANDERSON |
|---|---|
| Type | Voter |
| State | AZ |
| Address | 5930 S JUNIPER STREET, TEMPE, AZ 85282 |
| Phone Number | 480-703-4315 |
| Email Address | [email protected] |
| Name | JOSH ANDERSON |
|---|---|
| Type | Voter |
| State | AZ |
| Address | 5930 S JUNIPER ST, TEMPE, AZ 85283 |
| Phone Number | 480-703-4315 |
| Email Address | [email protected] |
| Name | JOSH ANDERSON |
|---|---|
| Type | Independent Voter |
| State | FL |
| Address | 3700 SW 29TH TER, GAINESVILLE, FL 32608 |
| Phone Number | 352-246-4668 |
| Email Address | [email protected] |
| Name | JOSH ANDERSON |
|---|---|
| Type | Independent Voter |
| State | CO |
| Address | 2127 S ACOMA ST, DENVER, CO 80223 |
| Phone Number | 303-435-7941 |
| Email Address | [email protected] |
| Name | JOSH D ANDERSON |
|---|---|
| Visit Date | 4/13/10 8:30 |
| Appointment Number | U36624 |
| Type Of Access | VA |
| Appt Made | 8/25/10 19:08 |
| Appt Start | 9/3/10 9:00 |
| Appt End | 9/3/10 23:59 |
| Total People | 249 |
| Last Entry Date | 8/25/10 19:08 |
| Meeting Location | WH |
| Caller | VISITORS |
| Description | GROUP TOUR |
| Release Date | 12/31/2010 08:00:00 AM +0000 |
| Name | JOSH ANDERSON |
|---|---|
| Car | DODGE CALIBER |
| Year | 2007 |
| Address | 1756 WESTON LN, SHAKOPEE, MN 55379-4356 |
| Vin | 1B3HE78K57D536028 |
| Name | JOSH ANDERSON |
|---|---|
| Car | FORD FOCUS |
| Year | 2007 |
| Address | 910 N NELLIE CT, POST FALLS, ID 83854-9090 |
| Vin | 1FAFP31N27W138167 |
| Name | JOSH ANDERSON |
|---|---|
| Car | HONDA ACCORD |
| Year | 2007 |
| Address | 5252 174th St, Chippewa Falls, WI 54729-8704 |
| Vin | 1HGCM56347A042371 |
| Name | JOSH ANDERSON |
|---|---|
| Car | GMC SIERRA 1500 |
| Year | 2007 |
| Address | 100 PHEASANT RD, CLINTON, TN 37716-6660 |
| Vin | 3GTEC13C77G545773 |
| Name | Josh Anderson |
|---|---|
| Domain | gunsandboots.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2011-12-20 |
| Update Date | 2012-12-21 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 18812 93 Ave NW Edmonton AB T5T 4X4 |
| Registrant Country | CANADA |
| Name | JOSH ANDERSON |
|---|---|
| Domain | fearhero.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2007-10-29 |
| Update Date | 2013-09-30 |
| Registrar Name | ENOM, INC. |
| Registrant Address | PO BOX 181863 CASSELBERRY FL 32718 |
| Registrant Country | UNITED STATES |
| Name | JOSH ANDERSON |
|---|---|
| Domain | jandjwebworks.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2007-01-20 |
| Update Date | 2012-12-22 |
| Registrar Name | ENOM, INC. |
| Registrant Address | PO BOX 181863 CASSELBERRY FL 32718 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | joshandersonrealestate.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2006-04-21 |
| Update Date | 2012-06-08 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | JOSH ANDERSON |
|---|---|
| Domain | carnalmobile.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2006-11-02 |
| Update Date | 2013-10-04 |
| Registrar Name | ENOM, INC. |
| Registrant Address | PO BOX 181863 CASSELBERRY FL 32718 |
| Registrant Country | UNITED STATES |
| Name | JOSH ANDERSON |
|---|---|
| Domain | switchflics.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2006-11-02 |
| Update Date | 2013-10-04 |
| Registrar Name | ENOM, INC. |
| Registrant Address | PO BOX 181863 CASSELBERRY FL 32718 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | tnhomeprices.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2007-05-26 |
| Update Date | 2013-05-27 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | governorsclubbrentwoodtn.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-19 |
| Update Date | 2013-05-24 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | eastwoodneighbors.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-19 |
| Update Date | 2013-05-24 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | thlinx.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-08-25 |
| Update Date | 2013-08-17 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 432 Whispering Pines Ocean Springs Mississippi 39564 |
| Registrant Country | UNITED STATES |
| Name | JOSH ANDERSON |
|---|---|
| Domain | renaedrysdale.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2013-03-23 |
| Update Date | 2013-03-23 |
| Registrar Name | ENOM, INC. |
| Registrant Address | 66/38 WATERLOO CRES EAST PERTH WA 6004 |
| Registrant Country | AUSTRALIA |
| Name | JOSH ANDERSON |
|---|---|
| Domain | davidschimneyservice.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2009-11-01 |
| Update Date | 2013-11-02 |
| Registrar Name | ENOM, INC. |
| Registrant Address | 21702 W 122ND ST OLATHE KS 66061 |
| Registrant Country | UNITED STATES |
| Name | JOSH ANDERSON |
|---|---|
| Domain | joshandlori.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2012-08-11 |
| Update Date | 2013-10-18 |
| Registrar Name | ENOM, INC. |
| Registrant Address | 715 HERMAN ST. PETERBOROUGH ON J9J3B3 |
| Registrant Country | CANADA |
| Name | JOSH ANDERSON |
|---|---|
| Domain | oddsrlotto.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2007-01-28 |
| Update Date | 2012-12-30 |
| Registrar Name | ENOM, INC. |
| Registrant Address | PO BOX 181863 CASSELBERRY FL 32718 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | kellerwilliamsrealtynashville.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-04-15 |
| Update Date | 2013-03-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | waynefrierhome.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-09-10 |
| Update Date | 2013-09-11 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 2123 NW 11th Drive Chiefland FL 32626 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | definitivenetworkservices.com |
| Contact Email | [email protected] |
| Whois Sever | whois.liquidnetlimited.com |
| Create Date | 2009-03-10 |
| Update Date | 2013-03-02 |
| Registrar Name | LIQUIDNET LTD. |
| Registrant Address | 21702 W 122nd St Olathe KS 66061 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | phenomenalcompanies.com |
| Contact Email | [email protected] |
| Whois Sever | whois.register.com |
| Create Date | 2013-06-19 |
| Update Date | 2013-10-18 |
| Registrar Name | REGISTER.COM, INC. |
| Registrant Address | 42017 SE 149th Pl North Bend WA 98045 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | bildonconstruction.com |
| Contact Email | [email protected] |
| Whois Sever | whois.liquidnetlimited.com |
| Create Date | 2009-10-25 |
| Update Date | 2013-11-13 |
| Registrar Name | LIQUIDNET LTD. |
| Registrant Address | 21702 W 122nd St Olathe KS 66061 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | joshdanderson.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-17 |
| Update Date | 2012-09-26 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 42017 SE 149th PL North Bend Washington 98045 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | japhotog.com |
| Contact Email | [email protected] |
| Whois Sever | whois.misk.com |
| Create Date | 2007-07-24 |
| Update Date | 2013-10-13 |
| Registrar Name | MISK.COM, INC. |
| Registrant Address | 1181 Irene Pl. NE Bainbridge Island WA 98110 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | mentorsforsuccess.com |
| Contact Email | [email protected] |
| Whois Sever | whois.wildwestdomains.com |
| Create Date | 2002-12-04 |
| Update Date | 2012-12-05 |
| Registrar Name | WILD WEST DOMAINS, LLC |
| Registrant Address | 1900 Grassmere Street Boise Idaho 83709 |
| Registrant Country | UNITED STATES |
| Name | JOSH ANDERSON |
|---|---|
| Domain | carnalphone.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2006-11-02 |
| Update Date | 2013-10-04 |
| Registrar Name | ENOM, INC. |
| Registrant Address | PO BOX 181863 CASSELBERRY FL 32718 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | definitivenetworksolutions.com |
| Contact Email | [email protected] |
| Whois Sever | whois.liquidnetlimited.com |
| Create Date | 2009-03-10 |
| Update Date | 2013-03-02 |
| Registrar Name | LIQUIDNET LTD. |
| Registrant Address | 21702 W 122nd St Olathe KS 66061 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | telephonysupply.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2000-09-24 |
| Update Date | 2013-09-25 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 1715 N. Westshore Blvd.|Suite 250 Tampa Florida 33607 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | myjdsuccess.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-02-12 |
| Update Date | 2009-02-12 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 115 W Ririe hwy Ririe Idaho 83443 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | rapidcoresolutions.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2011-12-15 |
| Update Date | 2012-12-16 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 320 W. Kennedy Blvd.|Suite 650 Tampa Florida 33606 |
| Registrant Country | UNITED STATES |
| Name | JOSH ANDERSON |
|---|---|
| Domain | wirelessphd.com |
| Contact Email | [email protected] |
| Whois Sever | whois.enom.com |
| Create Date | 2005-02-02 |
| Update Date | 2013-01-04 |
| Registrar Name | ENOM, INC. |
| Registrant Address | PO BOX 181863 CASSELBERRY FL 32718 |
| Registrant Country | UNITED STATES |
| Name | Anderson, Josh |
|---|---|
| Domain | bestfreeminecraft.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2013-02-18 |
| Update Date | 2013-02-18 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 721 cline st Las Vegas NV 89145 |
| Registrant Country | UNITED STATES |