We have found 9 public records related to Josh Anderson in Tennessee . There is 1 business registration records connected with Josh Anderson in public record. This business is registered in Tennessee state. This business is engaged in Motion Pictures (Entertainment) industry. There is one profile of government employee in our database. This person works in Tennessee state. Average wage of employees is $21,099.
| Name / Names | Josh Anderson |
|---|---|
| Age | 100 |
| Birth Date | 1923 |
| Person | 1456 Trezevant St, Memphis, TN 38108 |
| Phone Number | 901-458-7122 |
| Possible Relatives |
Ruby M Anderson Randy L Anderson Mary L Anderson Bessie L Anderson Djuan Anderson Octavious Anderson Stacey L Anderson Kizzy Marie Anderson K Anderson |
| Previous Address |
2844 Leafy Hollow Dr #1, Memphis, TN 38127 4569 Sunnybrook St, Memphis, TN 38127 4569 Sunny View Dr, Memphis, TN 38127 795 Stonewall St, Memphis, TN 38107 4569 Sunnybrook, Memphis, TN 37501 |
| Business Name | Hamilton Place Mall Cinema 9 |
|---|---|
| Person Name | Josh Anderson |
| Position | company contact |
| State | TN |
| Address | 2100 Hamilton Place Blvd Chattanooga TN 37421-6006 |
| Industry | Motion Pictures (Entertainment) |
| SIC Code | 7832 |
| SIC Description | Motion Picture Theaters, Except Drive-In |
| Phone Number | 423-899-5522 |
| State | TN |
|---|---|
| Calendar Year | 2018 |
| Employer | County Of Morgan |
| Name | Anderson Josh |
| Annual Wage | $21,099 |
| Name | JOSH ANDERSON |
|---|---|
| Car | GMC SIERRA 1500 |
| Year | 2007 |
| Address | 100 PHEASANT RD, CLINTON, TN 37716-6660 |
| Vin | 3GTEC13C77G545773 |
| Name | Josh Anderson |
|---|---|
| Domain | joshandersonrealestate.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2006-04-21 |
| Update Date | 2012-06-08 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | tnhomeprices.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2007-05-26 |
| Update Date | 2013-05-27 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | governorsclubbrentwoodtn.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-19 |
| Update Date | 2013-05-24 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | eastwoodneighbors.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-19 |
| Update Date | 2013-05-24 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |
| Name | Josh Anderson |
|---|---|
| Domain | kellerwilliamsrealtynashville.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-04-15 |
| Update Date | 2013-03-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 30 Burton Hills Blvd.|Suite 175 Nashville Tennessee 37215 |
| Registrant Country | UNITED STATES |