We have found 125 public records related to Wayne Shifflett in 12 states . Ethnicity of all people found is French. Education levels of people we have found are: Completed Graduate School, Completed College and Completed High School. All people found speak English language. There are 6 business registration records connected with Wayne Shifflett in public records. The businesses are registered in 4 states: GA, PA, AZ and VA. The businesses are engaged in 5 industries: Miscellaneous Retail (Stores), Wholesale Trade - Nondurable Goods, Construction - Special Trade Contractors (Construction), Administration Of Environmental Quality And Housing Programs (Administration) and Automotive Repair, Services And Parking. There are 5 profiles of government employees in our database. Job titles of people found are: Construction Projects Consultant and Maintenance & Construction Supt - Ses. All people work in Florida state. Average wage of employees is $43,102.
Name / Names | Wayne T Shifflett |
---|---|
Age | 47 |
Birth Date | 1977 |
Person | 35 Ross Rd, Preston, CT 06365 |
Possible Relatives |
Curtis W Shifflett David C Shifflett Deborah F Shifflett Kimberly R Shifflett |
Previous Address | 967 Long Cove Rd #10, Gales Ferry, CT 06335 |
Name / Names | Wayne A Shifflett |
---|---|
Age | 51 |
Birth Date | 1973 |
Person | 2480 Sawmill Run, Elkton, VA 22827 |
Possible Relatives |
Mary F Shifflett Mindy L Shifflett Floyd W Shifflett Mary F Shifflett Floyd W Shifflett Amanda J Shifflett |
Previous Address |
558 Wood Haven,Elkton, VA 22827 167 RR 4,Elkton, VA 22827 RR 4,Elkton, VA 22827 284A RR 4,Elkton, VA 22827 628 Hwy,Elkton, VA 22827 892 Hwy,Elkton, VA 22827 291 RR 5,Elkton, VA 22827 Hwy,Elkton, VA 22827 167 PO Box,Elkton, VA 22827 294 PO Box,Elkton, VA 22827 284A PO Box,Elkton, VA 22827 400 PO Box,Elkton, VA 22827 |
Available |
Name / Names | Wayne E Shifflett |
---|---|
Age | 60 |
Birth Date | 1964 |
Person | 1629 Meridian, Charlottesvle, VA 22902 |
Possible Relatives |
Janet G Shifflett Carla Sue Shifflett Rebecca E Shifflett Gay Shifflett Roy E Shifflett |
Previous Address |
1629 Meridian,Charlottesville, VA 22902 513 Main,Charlottesville, VA 22902 805 Orangedale,Charlottesville, VA 22903 805 Montrose,Charlottesville, VA 22902 60 PO Box,Charlottesville, VA 22902 |
Name / Names | Wayne R Shifflett |
---|---|
Age | 60 |
Birth Date | 1964 |
Person | 349 Radio, Elizabethtown, PA 17022 |
Possible Relatives |
Brenda Lee Shifflettb Douglas E Shifflett Pamela S Shifflet Cheryl Lyn Shifflett |
Previous Address |
1875 Habecker,Columbia, PA 17512 153 Stump,Columbia, PA 17512 441 Market,Marietta, PA 17547 1885 Habecker,Columbia, PA 17512 |
Name / Names | Wayne Edward Shifflett |
---|---|
Age | 61 |
Birth Date | 1963 |
Person | 676 Highway 314a, Silver Springs, FL 34488 |
Phone Number | 352-625-5358 |
Possible Relatives |
Donna L Shifflett Brian W Shifflett Eric L Shifflett |
Previous Address |
676 Highway 314a, Silver Spgs, FL 34488 676 Ne C-314a, Silver Springs, FL 428 14th St, Ocala, FL 34471 428 14th St, Ocala, FL 34474 676 Co Hwy, Silver Spgs, FL 34488 676 Cty #314 A, Silver Springs, FL 34488 676 Ne C314a #314A, Silver Springs, FL 34488 538A PO Box, Belleview, FL 34421 676 314a, Silver Springs, FL 34488 676 C #314A, Silver Springs, FL 34488 676 Hwy 314 A, Silver Springs, FL 32688 471 Lake Rd #555, Ocala, FL 34472 |
Associated Business | R&W Construction Unlimited Inc |
Name / Names | Wayne A Shifflett |
---|---|
Age | 61 |
Birth Date | 1963 |
Person | 178 Wilkinson, Concord, NC 28025 |
Possible Relatives |
Jeannie Renee Shifflett Carolyn Shifflett Hinson James Anthony Shifflett Christopher Wayne Shifflett |
Previous Address |
119 Barbee,Concord, NC 28027 100 Wilkinson,Concord, NC 28025 1781 Wilkinson,Concord, NC 28025 295 Odell,Concord, NC 28025 1999 Coley,Concord, NC 28027 348 Vance,Concord, NC 28025 4084 Po,Concord, NC 28027 4084 PO Box,Concord, NC 28025 4084 PO Box,Concord, NC 28027 145 Brookwood,Concord, NC 28025 |
Name / Names | Wayne C Shifflett |
---|---|
Age | 61 |
Birth Date | 1963 |
Person | 1004 Perth, Virginia Beach, VA 23455 |
Possible Relatives |
Michelle Lynn Shifflett Claude W Shifflett David L Shifflett Janet B Shifflett Gary W Shifflett Laura Melanie Shifflett Janet E Shifflett Ashley Shifflett Amber Shifflett |
Previous Address | 1537 Aspin,Norfolk, VA 23502 |
Available |
Name / Names | Wayne L Shifflett |
---|---|
Age | 63 |
Birth Date | 1961 |
Person | 3307 Dona, Alexandria, VA 22303 |
Possible Relatives |
Dawn N Shifflett Daniel Shifflett Roy L Shifflett |
Previous Address |
6653 Tower,Alexandria, VA 22306 7204 Sipes,Annandale, VA 22003 |
Available |
Name / Names | Wayne C Shifflett |
---|---|
Age | 66 |
Birth Date | 1958 |
Person | 9247 Mimosa, La Plata, MD 20646 |
Possible Relatives |
Cheryl Ann Shifflett Sheri Shifflett Shauna M Shifflett |
Previous Address |
4153 Mimosa,La Plata, MD 20646 7709 Earnshaw,Brandywine, MD 20613 |
Available |
Name / Names | Wayne D Shifflett |
---|---|
Age | 68 |
Birth Date | 1956 |
Person | 295 Montevista, Orange, VA 22960 |
Possible Relatives |
Tammy Renee Harper Sally A Shifflett |
Previous Address |
274 Cathedral,Orange, VA 22960 General Delivery,Locust Dale, VA 22948 |
Name / Names | Wayne Edward Shifflett |
---|---|
Age | 69 |
Birth Date | 1955 |
Person | 86 Bluestone, Weyers Cave, VA 24486 |
Possible Relatives |
Marion J Shifflett Vivian S Shifflett June Anne Shifflett David Shifflett Charles N Shifflett |
Previous Address |
RR 1,Weyers Cave, VA 24486 379 RR 1,Weyers Cave, VA 24486 353 RR 1,Weyers Cave, VA 24486 |
Available |
Name / Names | Wayne M Shifflett |
---|---|
Age | 70 |
Birth Date | 1954 |
Person | 253 Mountain View, Reading, PA 19607 |
Previous Address |
528 Lancaster,Reading, PA 19611 253 Mount Penn,Reading, PA 19607 1224 Muhlenberg,Reading, PA 19602 1214 Muhlenberg,Reading, PA 19602 115 9th,Reading, PA 19601 |
Available |
Name / Names | Wayne Michael Shifflett |
---|---|
Age | 70 |
Birth Date | 1954 |
Person | 213 Raymond, Alexandria, VA 22301 |
Possible Relatives | Violet Shifflett |
Name / Names | Wayne C Shifflett |
---|---|
Age | 73 |
Birth Date | 1951 |
Person | 4545 McMillian, Sumerduck, VA 22742 |
Possible Relatives |
Nannette T Shifflett Carol S Whiteryder Christine M Shifflett Amanda J Shifflett Thomas D Shifflett |
Previous Address |
5510 Meadowvale,Warrenton, VA 20187 6,Warrenton, VA 20188 Box,Warrenton, VA 20188 808 Wide Oak,Warrenton, VA 20186 244 Monroe,Warrenton, VA 20186 6250 Millwood,Warrenton, VA 20187 641 Millwood,Warrenton, VA 20187 142 PO Box,Warrenton, VA 20188 142 RR 6,Warrenton, VA 20187 641 Millwood,Warrenton, VA 22186 105 Nalls,Sterling, VA 20164 |
Name / Names | Wayne G Shifflett |
---|---|
Age | 78 |
Birth Date | 1946 |
Person | 1480 PO Box, Harrisonburg, VA 22803 |
Possible Relatives |
Carolyn W Shifflett James T Shifflett Wg Shifflett |
Previous Address |
1511 Liberty,Harrisonburg, VA 22802 5002 42nd,Okeechobee, FL 34974 103 Belmont,Harrisonburg, VA 22801 |
Associated Business | SHIFFLETT LIVESTOCK, INC, WAYNE G |
Name / Names | Wayne R Shifflett |
---|---|
Age | 79 |
Birth Date | 1945 |
Person | 458 Creek, Front Royal, VA 22630 |
Possible Relatives |
Joan D Mcdaniel Diane Shiflett Joan Shifflett |
Previous Address |
119 Laing,Front Royal, VA 22630 140 Duck,Front Royal, VA 22630 3038 Happy Creek,Front Royal, VA 22651 827 16th,Front Royal, VA 22630 3038 Happy,Front Royal, VA 22630 3038 Happy Creek,Front Royal, VA 22630 |
Name / Names | Wayne L Shifflett |
---|---|
Age | 90 |
Birth Date | 1933 |
Person | 6334 Rogers, Stewartsville, MO 64490 |
Possible Relatives |
Michelle M Shifflett Sherry Louise Shifflett |
Previous Address |
7610 Paradise,Kansas City, MO 64152 6710 Paradise,Kansas City, MO 64152 12171 PO Box,Parkville, MO 64152 |
Available |
Name / Names | Wayne E Shifflett |
---|---|
Age | N/A |
Person | 86 BLUESTONE DR, WEYERS CAVE, VA 24486 |
Phone Number | 540-234-8985 |
Name / Names | Wayne G Shifflett |
---|---|
Age | N/A |
Person | 1511 N LIBERTY ST, HARRISONBURG, VA 22802 |
Phone Number | 540-434-3295 |
Name / Names | Wayne E Shifflett |
---|---|
Age | N/A |
Person | 676 N HIGHWAY 314A, SILVER SPRINGS, FL 34488 |
Phone Number | 352-625-5358 |
Name / Names | Wayne J Shifflett |
---|---|
Age | N/A |
Person | 22 LEE HALL DR, SAVANNAH, GA 31419 |
Phone Number | 912-961-0963 |
Name / Names | Wayne M Shifflett |
---|---|
Age | N/A |
Person | 253 MOUNTAIN VIEW RD, READING, PA 19607 |
Phone Number | 610-603-0499 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 3055 ADVANCE MILLS RD, RUCKERSVILLE, VA 22968 |
Phone Number | 434-985-6025 |
Name / Names | Wayne E Shifflett |
---|---|
Age | N/A |
Person | 2212 OAK BAY LN, HENRICO, VA 23233 |
Phone Number | 804-741-0633 |
Name / Names | Wayne E Shifflett |
---|---|
Age | N/A |
Person | 1629 MERIDIAN ST, CHARLOTTESVILLE, VA 22902 |
Phone Number | 434-296-9480 |
Name / Names | Wayne C Shifflett |
---|---|
Age | N/A |
Person | 4545 MCMILLIAN DR, SUMERDUCK, VA 22742 |
Phone Number | 540-222-6376 |
Name / Names | Wayne A Shifflett |
---|---|
Age | N/A |
Person | 72 COSBY MILL LN, GROTTOES, VA 24441 |
Phone Number | 540-249-3802 |
Name / Names | Wayne W Shifflett |
---|---|
Age | N/A |
Person | 3109 ROLLING RD, SCOTTSVILLE, VA 24590 |
Phone Number | 434-971-5551 |
Name / Names | Wayne F Shifflett |
---|---|
Age | N/A |
Person | 1207 Colonial, Norfolk, VA 23517 |
Possible Relatives | Robert Shifflett |
Previous Address |
7257 Marsh,Norfolk, VA 23523 514201 Suncatcher D,Centreville, VA 20121 1562 Chela,Norfolk, VA 23503 2101 Hampton,Norfolk, VA 23517 |
Name / Names | Wayne A Shifflett |
---|---|
Age | N/A |
Person | 2480 SAWMILL RUN LN, ELKTON, VA 22827 |
Name / Names | Wayne M Shifflett |
---|---|
Age | N/A |
Person | 247 MOUNTAIN VIEW RD, SHILLINGTON, PA 19607 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 743 CARSON AVE, OXON HILL, MD 20745 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 927 Beverley, Staunton, VA 24401 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 701 PO Box, Gordonsville, VA 22942 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 3307 DONA AVE, ALEXANDRIA, VA 22303 |
Phone Number | 703-329-8575 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 7754 BLUE JAY CT, ALEXANDRIA, VA 22306 |
Phone Number | 703-619-1525 |
Name / Names | Wayne C Shifflett |
---|---|
Age | N/A |
Person | 254 CARRIAGE CHASE CIR, WARRENTON, VA 20186 |
Phone Number | 540-347-3669 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 213 E RAYMOND AVE, ALEXANDRIA, VA 22301 |
Phone Number | 703-548-5492 |
Name / Names | Wayne A Shifflett |
---|---|
Age | N/A |
Person | 1911 PACHEA TRL, ROUND ROCK, TX 78665 |
Phone Number | 512-238-0989 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 558 WOOD HAVEN LN, ELKTON, VA 22827 |
Phone Number | 540-298-8688 |
Name / Names | Wayne A Shifflett |
---|---|
Age | N/A |
Person | 119 BARBEE RD SW, CONCORD, NC 28027 |
Phone Number | 704-782-2283 |
Name / Names | Wayne G Shifflett |
---|---|
Age | N/A |
Person | 5002 SE 42ND TRCE, OKEECHOBEE, FL 34974 |
Phone Number | 863-763-3272 |
Name / Names | Wayne T Shifflett |
---|---|
Age | N/A |
Person | 35 ROSS RD, PRESTON, CT 6365 |
Phone Number | 860-892-1704 |
Name / Names | Wayne Sr Shifflett |
---|---|
Age | N/A |
Also Known As | Wayne Shifflett |
Person | 401 Albemarle St, York, PA 17403 |
Phone Number | 717-848-4732 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 44 Landsend, Gaithersburg, MD 20878 |
Possible Relatives |
David Wayne Shifflett Theresa Shifflett Thomas Wayne Shifflett David W Shifflett Kelly L Shifflett David W Shifflet Rebecca A Shifflett |
Name / Names | Wayne M Shifflett |
---|---|
Age | N/A |
Person | 9203 Dunbarton Ct, Knoxville, TN 37923 |
Previous Address | 2627 Hixson Pike #251, Chattanooga, TN 37415 |
Name / Names | Wayne D Shifflett |
---|---|
Age | N/A |
Person | 295 MONTEVISTA AVE, ORANGE, VA 22960 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 1537 ASPIN ST, NORFOLK, VA 23502 |
Name / Names | Wayne M Shifflett |
---|---|
Age | N/A |
Person | 528 LANCASTER AVE, READING, PA 19611 |
Name / Names | Wayne W Shifflett |
---|---|
Age | N/A |
Person | 333 Mockingbird, Lexington, KY 40503 |
Possible Relatives |
Sally M Shifflett James W Shifflett |
Previous Address | 905 Limestone,Lexington, KY 40505 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 217 RR 1 POB, Port Republic, VA 24471 |
Possible Relatives | Karen Slyshifflett |
Previous Address | 4124 RR 1 POB,Port Republic, VA 24471 |
Name / Names | Wayne Shifflett |
---|---|
Age | N/A |
Person | 414 NE MAPLE DR, KANSAS CITY, MO 64118 |
Phone Number | 816-452-2317 |
Name / Names | Wayne K Shifflett |
---|---|
Age | N/A |
Person | 5818 PRATT CT, ALEXANDRIA, VA 22310 |
Business Name | Waynes Auto Body Repair |
---|---|
Person Name | Wayne Shifflett |
Position | company contact |
State | VA |
Address | 3055 Advance Mills Rd Ruckersville VA 22968-3207 |
Industry | Automotive Repair, Services And Parking |
SIC Code | 7532 |
SIC Description | Top And Body Repair And Paint Shops |
Phone Number | 434-985-2103 |
Business Name | Wayne's Auto Body Repair |
---|---|
Person Name | Wayne Shifflett |
Position | company contact |
State | VA |
Address | 3057 Advance Mills Rd Ruckersville VA 22968-3207 |
Industry | Automotive Repair, Services And Parking |
SIC Code | 7532 |
SIC Description | Top And Body Repair And Paint Shops |
Phone Number | 434-985-2103 |
Number Of Employees | 1 |
Annual Revenue | 114130 |
Business Name | Wayne G Shifflett Livestock |
---|---|
Person Name | Wayne Shifflett |
Position | company contact |
State | VA |
Address | P.O. BOX 1480 Harrisonburg VA 22803-1480 |
Industry | Wholesale Trade - Nondurable Goods |
SIC Code | 5154 |
SIC Description | Livestock |
Phone Number | 540-434-3295 |
Business Name | Mingue Magic Shop |
---|---|
Person Name | Wayne Shifflett |
Position | company contact |
State | PA |
Address | 528 Lancaster Ave Reading PA 19611-1634 |
Industry | Miscellaneous Retail (Stores) |
SIC Code | 5947 |
SIC Description | Gift, Novelty, And Souvenir Shop |
Business Name | Electric Lemonade LLC |
---|---|
Person Name | Wayne Shifflett |
Position | company contact |
State | GA |
Address | P.O. BOX 1032 Acworth GA 30101-8932 |
Industry | Construction - Special Trade Contractors (Construction) |
SIC Code | 1731 |
SIC Description | Electrical Work |
Phone Number | 404-456-2503 |
Business Name | Buenos Ares Nat Wldlife Refuge |
---|---|
Person Name | Wayne Shifflett |
Position | company contact |
State | AZ |
Address | P.O. BOX 109 Sasabe AZ 85633-0109 |
Industry | Administration of Environmental Quality and Housing Programs (Administration) |
SIC Code | 9512 |
SIC Description | Land, Mineral, And Wildlife Conservation |
Phone Number | 520-823-4251 |
State | FL |
---|---|
Calendar Year | 2018 |
Employer | Department Of Corrections |
Job Title | Construction Projects Consultant Ii |
Name | Shifflett Wayne E |
Annual Wage | $49,539 |
State | FL |
---|---|
Calendar Year | 2017 |
Employer | Dept Of Corrections - Region 2 |
Name | Shifflett Wayne E |
Annual Wage | $43,077 |
State | FL |
---|---|
Calendar Year | 2017 |
Employer | Dc - Corrections |
Job Title | Maintenance & Construction Supt - Ses |
Name | Shifflett Wayne E |
Annual Wage | $44,126 |
State | FL |
---|---|
Calendar Year | 2016 |
Employer | Dept Of Corrections - Region 3 |
Name | Shifflett Wayne E |
Annual Wage | $39,963 |
State | FL |
---|---|
Calendar Year | 2015 |
Employer | Dept Of Corrections - Region 3 |
Name | Shifflett Wayne E |
Annual Wage | $38,803 |
Name | Wayne C Shifflett |
---|---|
Address | 4545 Mcmillian Dr Sumerduck VA 22742 -2069 |
Mobile Phone | 540-222-6376 |
Gender | Male |
Date Of Birth | 1948-08-11 |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $75,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 4 |
Range Of New Credit | 501 |
Education | Completed Graduate School |
Language | English |
Name | Wayne Shifflett |
---|---|
Address | 9247 Mimosa Dr La Plata MD 20646 -3635 |
Phone Number | 301-753-0916 |
Mobile Phone | 301-537-6658 |
[email protected] | |
Gender | Male |
Date Of Birth | 1955-01-21 |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $100,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 5001 |
Education | Completed Graduate School |
Language | English |
Name | Wayne E Shifflett |
---|---|
Address | 676 N Highway 314a Silver Springs FL 34488 -5135 |
Phone Number | 352-625-0639 |
Mobile Phone | 904-994-9640 |
Gender | Male |
Date Of Birth | 1960-02-20 |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $40,000 |
Estimated Net Worth | $50,000 |
Range Of New Credit | 5001 |
Education | Completed College |
Language | English |
Name | Wayne E Shifflett |
---|---|
Address | 805 Montrose Ave Charlottesville VA 22902 -6147 |
Phone Number | 434-295-7713 |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $15,000 |
Estimated Net Worth | $50,000 |
Range Of New Credit | 1001 |
Education | Completed High School |
Language | English |
Name | Wayne E Shifflett |
---|---|
Address | 1629 Meridian St Charlottesville VA 22902 -6339 |
Phone Number | 434-296-9480 |
Mobile Phone | 434-296-9480 |
[email protected] | |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $40,000 |
Estimated Net Worth | $25,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Wayne Shifflett |
---|---|
Address | 3109 Rolling Rd Scottsville VA 24590 -4214 |
Phone Number | 434-971-5551 |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $60,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 4 |
Range Of New Credit | 1001 |
Education | Completed High School |
Language | English |
Name | Wayne E Shifflett |
---|---|
Address | 86 Bluestone Dr Weyers Cave VA 24486 -2300 |
Phone Number | 540-234-8985 |
[email protected] | |
Gender | Male |
Date Of Birth | 1981-05-01 |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $150,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 3 |
Range Of New Credit | 0 |
Education | Completed High School |
Language | English |
Name | Wayne A Shifflett |
---|---|
Address | 72 Cosby Mill Ln Grottoes VA 24441 -4605 |
Phone Number | 540-249-3802 |
[email protected] | |
Gender | Male |
Date Of Birth | 1941-09-23 |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $40,000 |
Estimated Net Worth | $250,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Wayne Shifflett |
---|---|
Address | 558 Wood Haven Ln Elkton VA 22827 -4141 |
Phone Number | 540-298-8688 |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $40,000 |
Estimated Net Worth | $100,000 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Wayne D Shifflett |
---|---|
Address | 295 Montevista Ave Orange VA 22960 -1221 |
Phone Number | 540-672-9042 |
[email protected] | |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $40,000 |
Estimated Net Worth | $50,000 |
Lines Of Credit Trade Counter | 2 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Wayne M Shifflett |
---|---|
Address | 253 Mountain View Rd Reading PA 19607 -9513 |
Phone Number | 610-603-0499 |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $100,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Wayne R Shifflett |
---|---|
Address | 349 Radio Rd Elizabethtown PA 17022 LOT 10-8935 |
Phone Number | 717-361-0254 |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $65,000 |
Estimated Net Worth | $100,000 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Wayne C Shifflett |
---|---|
Address | 1537 Aspin St Norfolk VA 23502 -1624 |
Phone Number | 757-853-4773 |
Telephone Number | 757-337-7604 |
Mobile Phone | 757-337-7604 |
[email protected] | |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $55,000 |
Estimated Net Worth | $50,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 1001 |
Education | Completed High School |
Language | English |
Name | Wayne Shifflett |
---|---|
Address | 4400 Eames Ln Woodbridge VA 22193 -2632 |
Phone Number | 804-224-8456 |
Gender | Male |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $35,000 |
Estimated Net Worth | $100,000 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Wayne E Shifflett |
---|---|
Address | 2212 Oak Bay Ln Henrico VA 23233 -3540 |
Phone Number | 804-741-0633 |
Gender | Male |
Date Of Birth | 1946-12-09 |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $100,000 |
Estimated Net Worth | $250,000 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Wayne J Shifflett |
---|---|
Address | 22 Lee Hall Dr Savannah GA 31419 -8821 |
Phone Number | 912-961-0963 |
Gender | Male |
Date Of Birth | 1976-03-29 |
Ethnicity | French |
Ethnic Group | Western European |
Estimated Household Income | $50,000 |
Estimated Net Worth | $25,000 |
Lines Of Credit Trade Counter | 1 |
Education | Completed College |
Language | English |
Name | WAYNE SHIFFLETT & CHERYL SHIFFLETT |
---|---|
Address | 9247 Mimosa Drive La Plata MD |
Value | 95500 |
Landvalue | 95500 |
Buildingvalue | 161100 |
Landarea | 31,101 square feet |
Airconditioning | yes |
Numberofbathrooms | 2.1 |
Name | WAYNE SHIFFLETT |
---|---|
Address | 119 Barbee Road Concord NC |
Value | 27500 |
Landvalue | 27500 |
Buildingvalue | 77750 |
Numberofbathrooms | 2 |
Bedrooms | 3 |
Numberofbedrooms | 3 |
Name | WAYNE M SHIFFLETT |
---|---|
Address | 5373 A Bedford Terrace Alexandria VA |
Value | 26000 |
Landvalue | 26000 |
Buildingvalue | 106130 |
Bedrooms | 2 |
Numberofbedrooms | 2 |
Type | Carpet Or Carpet/Tile |
Basement | None |
Name | WAYNE K SHIFFLETT |
---|---|
Address | 5818 Pratt Court Alexandria VA |
Value | 163000 |
Landvalue | 163000 |
Buildingvalue | 241170 |
Landarea | 15,003 square feet |
Bedrooms | 4 |
Numberofbedrooms | 4 |
Type | Hardwood |
Basement | Full |
Name | WAYNE G SHIFFLETT |
---|---|
Year Built | 1979 |
Address | 412 Cloverleaf Boulevard Deltona FL |
Value | 15600 |
Landvalue | 15600 |
Buildingvalue | 63556 |
Airconditioning | Yes |
Numberofbathrooms | 2 |
Bedrooms | 2 |
Numberofbedrooms | 2 |
Type | Single Family |
Price | 70332 |
Name | SHIFFLETT WAYNE G & MONGOLD AU |
---|---|
Physical Address | 5002 SE 42ND TRAC, OKEECHOBEE, FL 34974 |
Owner Address | PO BOX 1480, HARRISONBURG, VA 22803 |
County | Okeechobee |
Year Built | 2002 |
Area | 1330 |
Land Code | Single Family |
Address | 5002 SE 42ND TRAC, OKEECHOBEE, FL 34974 |
Name | SHIFFLETT WAYNE |
---|---|
Physical Address | 676 NE HWY 314A, SILVER SPRINGS, FL 34488 |
Owner Address | 676 NE COUNTY HWY 314A, SILVER SPRINGS, FL 34488 |
Ass Value Homestead | 40933 |
Just Value Homestead | 40933 |
County | Marion |
Year Built | 1964 |
Area | 1408 |
Applicant Status | Husband |
Co Applicant Status | Wife |
Land Code | Single Family |
Address | 676 NE HWY 314A, SILVER SPRINGS, FL 34488 |
Name | SHIFFLETT G WAYNE |
---|---|
Physical Address | 412 CLOVERLEAF BLVD, DELTONA, FL 32725 |
Ass Value Homestead | 62756 |
Just Value Homestead | 62756 |
County | Volusia |
Year Built | 1979 |
Area | 2879 |
Applicant Status | Other (Examples: single, joint tenants ? not |
Land Code | Single Family |
Address | 412 CLOVERLEAF BLVD, DELTONA, FL 32725 |
Name | WAYNE SHIFFLETT |
---|---|
Type | Democrat Voter |
State | VA |
Address | 1537 ASPIN ST, NORFOLK, VA 23502 |
Phone Number | 757-337-7604 |
Email Address | [email protected] |
Name | WAYNE SHIFFLETT |
---|---|
Type | Voter |
State | NC |
Address | 178 WILKINSON CT SE #1, CONCORD, NC 28025 |
Phone Number | 704-450-0298 |
Email Address | [email protected] |
Name | WAYNE SHIFFLETT |
---|---|
Type | Voter |
State | VA |
Address | 848 LONGSHOT LN., ROCHELLE, VA 22738 |
Phone Number | 540-672-1347 |
Email Address | [email protected] |
Name | WAYNE SHIFFLETT |
---|---|
Type | Democrat Voter |
State | VA |
Address | 1629 MERIDIAN ST, CHARLOTTESVILLE, VA 22902 |
Phone Number | 434-296-9480 |
Email Address | [email protected] |
Name | WAYNE SHIFFLETT |
---|---|
Car | GMC SIERRA 1500 |
Year | 2012 |
Address | 2 Wild Flower Cir, Hampton, VA 23669-1170 |
Vin | 1GTR2VE02CZ270158 |
Phone | 757-561-6980 |
Name | WAYNE SHIFFLETT |
---|---|
Car | GMC YUKON XL |
Year | 2010 |
Address | PO Box 1480, Harrisonburg, VA 22803-1480 |
Vin | 1GKUKKE36AR118453 |
Phone | 540-896-1090 |
Name | WAYNE SHIFFLETT |
---|---|
Car | NISSAN FRONTIER |
Year | 2010 |
Address | 86 BLUESTONE DR, WEYERS CAVE, VA 24486-2300 |
Vin | 1N6AD0FV2AC404944 |
Phone | 540-234-8985 |
Name | Shifflett, Wayne |
---|---|
Domain | marijuanaattorneys.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2008-10-11 |
Update Date | 2012-05-02 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | tuscaloosaduilawyer.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-11-14 |
Update Date | 2013-08-09 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | lawfirmsamerica.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2004-07-27 |
Update Date | 2013-04-20 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | californiaduiconsequences.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2011-10-24 |
Update Date | 2013-09-17 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | duipunishmentgeorgia.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2011-10-24 |
Update Date | 2013-09-17 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | secureformprocessing.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2010-01-04 |
Update Date | 2010-03-18 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | duidlaws.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2010-06-29 |
Update Date | 2013-06-25 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | woodbridgeduilawyer.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-11-12 |
Update Date | 2013-08-09 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | fairfaxcountyduilawyer.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-11-12 |
Update Date | 2013-04-20 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | duiamerica.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2005-02-27 |
Update Date | 2011-11-28 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | fallschurchduilawyer.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-11-12 |
Update Date | 2013-04-20 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | duiwiki.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-02-10 |
Update Date | 2013-01-02 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | atlantaroofingguy.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2009-02-23 |
Update Date | 2013-01-02 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | duilawfirmmarketing.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2011-03-10 |
Update Date | 2013-02-16 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | larrykohn.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2010-09-21 |
Update Date | 2013-04-20 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | michellestill.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2008-06-24 |
Update Date | 2013-04-20 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | virginiaspeedingticketlawyer.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-11-19 |
Update Date | 2013-09-17 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | duifinesgeorgia.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2011-10-24 |
Update Date | 2013-09-17 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | fredericksburgduilawyer.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-11-12 |
Update Date | 2013-04-20 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | newyorkdwilaws.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2006-06-11 |
Update Date | 2013-11-08 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | rescuedawg.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2009-05-29 |
Update Date | 2013-04-19 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | mariettaduilawyer.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-11-12 |
Update Date | 2013-04-20 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | duiattorneysatlantaga.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2011-10-15 |
Update Date | 2013-08-02 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | bankruptcylawfirmmarketing.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2011-03-10 |
Update Date | 2013-02-16 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | missouridrunkdriving.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2006-05-23 |
Update Date | 2013-04-19 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | duichargesgeorgia.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2011-10-24 |
Update Date | 2013-09-17 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | newportnewsduilawyer.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-12-06 |
Update Date | 2012-05-02 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | wayneshifflett.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2005-02-06 |
Update Date | 2011-01-23 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | buiattorneys.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2007-07-09 |
Update Date | 2013-06-25 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |
Name | Shifflett, Wayne |
---|---|
Domain | alabamaduipenalty.com |
Contact Email | [email protected] |
Whois Sever | whois.namesecure.com |
Create Date | 2008-07-16 |
Update Date | 2013-07-11 |
Registrar Name | NAMESECURE.COM |
Registrant Address | P.O. Box 61261 Savannah GA 31420 |
Registrant Country | UNITED STATES |