Roger Lowry

We have found 136 public records related to Roger Lowry in 24 states . Ethnicity of all people found is English. Education levels of people we have found are: Completed College, Completed Graduate School and Completed High School. All people found speak English language. There are 6 business registration records connected with Roger Lowry in public records. The businesses are registered in 5 states: KY, CO, IN, NE and AL. The businesses are engaged in 6 industries: Food Stores (Food), Gasoline Service Stations And Automotive Dealers (Automotive), Miscellaneous Retail (Stores), Commodity And Security Brokers, Exchanges, Services And Dealers (Finance), Mobile Home Dealers, Garden Supply, Building Materials And Hardware (Construction) and Insurance Brokers, Agents And Services (Insurance). There are 17 profiles of government employees in our database. Job titles of people found are: State Patrol Trooper, Security Personnel/Security Officer, School Secretary/Clerk, State Patrol Cadet, Security Personnel/Security Officer and School Secretary/Clerk. These employees work in 3 states: CO, KS and GA. Average wage of employees is $42,215.

Choose State

AL [3] AZ [7] CO [11] DC [1] FL [9] GA [18] IL [8] IN [4] KS [9] KY [4] MD [1] MI [11] MO [5] NC [2] NE [1] NY [5] OH [5] OK [4] PA [5] TN [4] TX [13] VA [2] WA [2] WY [2]

Basic Data for Roger Lowry - 57 records

Roger D Lowry

Name / Names	Roger D Lowry
Age	57
Birth Date	1967
Person	45 25, Reynolds, IN 47980
Possible Relatives	Missy Lowry

Roger Wayne Lowry

Name / Names	Roger Wayne Lowry
Age	58
Birth Date	1966
Person	8104 Fishermans Pointe Dr, Tampa, FL 33637
Phone Number	813-983-9330
Possible Relatives	Shirley Berry Lowry Michael B Lowry Jaquita Nell Lowry Raymond D Lowry Linda Sue Lowry Jaquita N Lowry
Previous Address	2014 Henderson Cir, Alpharetta, GA 30004 17111 Deer Trl, Alpharetta, GA 30004 10015 Old Columbia Rd #A200, Columbia, MD 21046 2701 Atlantic Ave, New Smyrna Beach, FL 32169 6991 Roswell Rd #H, Atlanta, GA 30328 5950 Symphony Woods Rd #510, Columbia, MD 21044 1018 Charing Martin Ct, Baltimore, MD 21229 2941 Caldwell Rd #A4, Atlanta, GA 30319 2701 Atlantic Ave, New Smyrna, FL 32169 241 Caldwell #A1, Meridian, GA 31319 9653 White Acar #C1, Columbia, MD 21045 335 Brook Ridge Ave, Atlanta, GA 30340 30 Padonia Rd, Lutherville Timonium, MD 21093 10209 Sunnylake Pl #B, Cockeysville, MD 21030 5119 Gerwiyn, Atlanta, GA 30366 80496 PO Box, Atlanta, GA 30366 329 Ohio Ave, Longwood, FL 32750

Roger W Lowry

Name / Names	Roger W Lowry
Age	58
Birth Date	1966
Person	8104 Fishermans Pointe, Temple Ter, FL 33637

Roger Lowry

Name / Names	Roger Lowry
Age	58
Birth Date	1966
Person	810A Fishermans Point, Tampa, FL 33637

Roger D Lowry

Name / Names	Roger D Lowry
Age	61
Birth Date	1963
Person	9756 Greenridge Heights Rd #R, Fairview Heights, IL 62208
Phone Number	618-397-3082
Previous Address	815 Charles St, Belleville, IL 62220 100 8th St, Belleville, IL 62220 9765 Greenridge, Fairview Heights, IL 62208 321 1st St, Belleville, IL 62220

Roger Odeil Lowry

Name / Names	Roger Odeil Lowry
Age	65
Birth Date	1959
Also Known As	Roger Odell Lowry
Person	516 Jeffrey Pine Ct, O Fallon, IL 62269
Phone Number	618-628-7110
Possible Relatives	Kim Denise Harrington
Previous Address	520 Jeffrey Pine Ct, O Fallon, IL 62269 1040 University Dr #5, Edwardsville, IL 62025 11019 Mollerus Dr #101, Saint Louis, MO 63138 3283 Maryville Rd, Granite City, IL 62040 136 Highwood Dr, Belleville, IL 62223 12415 Horizon Village Dr, Saint Louis, MO 63138 505 Chicago St, Peoria, IL 61605 3412 Prince George St, Atlanta, GA 30344 1906 Summercourt Dr, Jonesboro, GA 30236 3412 Prince George St, East Point, GA 30344 1208 Summercourt Dr, Jonesboro, GA 30236

Roger Scott Lowry

Name / Names	Roger Scott Lowry
Age	65
Birth Date	1959
Also Known As	Rogers Lowry
Person	14922 Caribbean Ln, Surprise, AZ 85379
Phone Number	623-815-7542
Possible Relatives	Rhonda F Lowry
Previous Address	18510 83rd Dr, Peoria, AZ 85382 10838 Joblanca Rd, Avondale, AZ 85323 8418 Willowbrook Dr, Peoria, AZ 85382 1004 Colcord Rd, Payson, AZ 85541 23995 Antelope Trl, Buckeye, AZ 85326 3233 26th Pl, Phoenix, AZ 85016 10518 Tonopah Dr, Peoria, AZ 85382 4202 Cholla St, Phoenix, AZ 85029

Roger O Lowry

Name / Names	Roger O Lowry
Age	65
Birth Date	1959
Person	15 Palm, Savannah, GA 31404

Roger W Lowry

Name / Names	Roger W Lowry
Age	66
Birth Date	1958
Person	131 Bryant St, Almena, KS 67622
Phone Number	785-669-2435
Possible Relatives	Bill Lowry Susan D Lowry Garry Alexander Lowry
Previous Address	710 Clay St, Hoisington, KS 67544 104 15th St, Hays, KS 67601 161 RR 1, Almena, KS 67622 840 RR 1, Almena, KS 67622 RR 1, Almena, KS 67622 161 PO Box, Almena, KS 67622 None, Almena, KS 67622

Roger D Lowry

Name / Names	Roger D Lowry
Age	69
Birth Date	1955
Also Known As	Roger B Lowry
Person	11028 1st Way, Okeechobee, FL 34972
Phone Number	863-467-2686
Possible Relatives	Bertha M Lowry Ronald Charles Lowry Debbie Vinson Lowry Debbie D Lowry Holly J Robbins Constable Lowry Richard L Lowry Jason W Lowry Thomas Eow Lowry
Previous Address	11058 1st Way, Okeechobee, FL 34972 805 7th Ave, Okeechobee, FL 34974 1 Way, Okeechobee, FL 34972 1441 Rainbow Ave, West Palm Beach, FL 33406 899 46th Ter, Okeechobee, FL 34972 1474 PO Box, Okeechobee, FL 34973

Roger L Lowry

Name / Names	Roger L Lowry
Age	70
Birth Date	1954
Person	4858 Rosemoore Ct, Suwanee, GA 30024
Phone Number	770-271-7967
Possible Relatives	Karen J Lowry L F Lowry Robert M Lowry
Previous Address	1609 Avon Ave #6, Tucker, GA 30084 2485 Hinton Rd, Dacula, GA 30019

Roger A Lowry

Name / Names	Roger A Lowry
Age	70
Birth Date	1954
Person	124 Lige Ct, Nicholasville, KY 40356
Phone Number	859-885-3729
Possible Relatives	Orena Lowry
Email	[email protected]

Roger L Lowry

Name / Names	Roger L Lowry
Age	72
Birth Date	1952
Also Known As	Roger Lee Lowry
Person	1299 Hospital Rd, Waterford, MI 48327
Phone Number	248-363-6747
Possible Relatives	Nena Gaye Lowry Jacqueline Rose Lowry Shawn R Lowry J R Lowry
Previous Address	13894 Shore Dr, Millersburg, MI 49759 559 Overlook St, White Lake, MI 48386 891 Lucille Dr, Wolverine Lake, MI 48390 8200 Pontiac Lake Rd #10, White Lake, MI 48386
Email	[email protected]

Roger V Lowry

Name / Names	Roger V Lowry
Age	76
Birth Date	1948
Also Known As	Roger K Lowry
Person	125 Roundtree Ct, Stockbridge, GA 30281
Phone Number	770-957-7039
Possible Relatives	Brenda G Lowry Kristen Coleen Lowry Barbara A Reinke Keith E Lowry
Previous Address	129 Roundtree Ct, Stockbridge, GA 30281
Email	[email protected]

Roger K Lowry

Name / Names	Roger K Lowry
Age	76
Birth Date	1948
Person	3670 60th, Davie, FL 33314
Possible Relatives	Brenda G Lowry

Roger B Lowry

Name / Names	Roger B Lowry
Age	81
Birth Date	1943
Person	2476 Q50 Rd, Cedaredge, CO 81413
Phone Number	970-856-6334
Possible Relatives	Robin L Hinchman Jean Morrison Bailey Jean M Lowry Jodie K Lowry Robin L Lowry Jeremy Orsen Lowry Audra Lafonta Lowry Obe Lowry Kayce Clark Lowry
Previous Address	292 Dixie Ave, Layton, UT 84041 24742 Cedar Mesa Rd, Cedaredge, CO 81413 002476 Q50 Rd, Cedaredge, CO 81413 024742 Cedar Mesa Rd, Cedaredge, CO 81413 2476 Q Rd #50, Cedaredge, CO 81413 1643 Cottonwood Dr, Cedaredge, CO 81413 85 PO Box, Cedaredge, CO 81413 2476 Rd #Q50, Cedaredge, CO 81413 391 26th Ave, Brighton, CO 80601 2476 50, Cedaredge, CO 81413 2476 50 Rd, Cedaredge, CO 81413 2476 1st #50, Cedaredge, CO 81413 11880 160th Ave, Brighton, CO 80602
Associated Business	Lowry Photography, Llc

Roger Stuart Lowry

Name / Names	Roger Stuart Lowry
Age	82
Birth Date	1942
Person	De Ave, Richland, MI 49083
Phone Number	269-629-4372
Possible Relatives	Elizabeth A Lowry Angela Marie Mcbain Wendy S Lowry Diana K Lowry Shirley A Lowry Ellie Lowry
Previous Address	7889 De Ave, Richland, MI 49083 7889 D Ave, Richland, MI 49083 9765 De Ave, Richland, MI 49083 720 Village St #1A, Kalamazoo, MI 49008

Roger A Lowry

Name / Names	Roger A Lowry
Age	N/A
Person	PO BOX 543, DOVE CREEK, CO 81324
Phone Number	970-677-3082

Roger B Lowry

Name / Names	Roger B Lowry
Age	N/A
Person	24742 CEDAR MESA RD, CEDAREDGE, CO 81413
Phone Number	970-856-6334

Roger L Lowry

Name / Names	Roger L Lowry
Age	N/A
Person	464 BELL GROVE RD, OHIOPYLE, PA 15470

Roger D Lowry

Name / Names	Roger D Lowry
Age	N/A
Person	11028 NE 1ST WAY, OKEECHOBEE, FL 34972

Roger D Lowry

Name / Names	Roger D Lowry
Age	N/A
Person	201 Washington, Reynolds, IN 47980
Previous Address	201 PO Box,Reynolds, IN 47980
Associated Business	LOWRY SLED RENTAL INC LOWRY SLED RENTAL INC LOWRY SLED RENTAL INC LOWRY BROTHERS HARDWARE, INC PATRIOT MOTOR SPORTS, INC PATRIOT MOTOR SPORTS, INC

Roger A Lowry

Name / Names	Roger A Lowry
Age	N/A
Person	112 ACTON CT, DELAWARE, OH 43015
Phone Number	740-369-3626

Roger L Lowry

Name / Names	Roger L Lowry
Age	N/A
Person	1299 S HOSPITAL RD, WATERFORD, MI 48327
Phone Number	248-363-6747

Roger S Lowry

Name / Names	Roger S Lowry
Age	N/A
Person	8418 W WILLOWBROOK DR, PEORIA, AZ 85382
Phone Number	623-815-7542

Roger O Lowry

Name / Names	Roger O Lowry
Age	N/A
Person	516 JEFFREY PINE CT, O FALLON, IL 62269
Phone Number	618-628-7110

Roger L Lowry

Name / Names	Roger L Lowry
Age	N/A
Person	5613 BOWSER AVE, FORT WAYNE, IN 46806
Phone Number	260-456-4138

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	4025 Summit, E Saint Louis, IL 62205

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	1259 Greene, Augusta, GA 30901

Roger S Lowry

Name / Names	Roger S Lowry
Age	N/A
Person	3614 60th, Phoenix, AZ 85033

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	3131 WESTOVER DR, MACON, GA 31204

Roger D Lowry

Name / Names	Roger D Lowry
Age	N/A
Person	243 MELISSA DR, PEMBROKE, NC 28372

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	304 N BRISTOW AVE, COWETA, OK 74429

Roger D Lowry

Name / Names	Roger D Lowry
Age	N/A
Person	4623 S SAINT LOUIS AVE, TULSA, OK 74105

Roger V Lowry

Name / Names	Roger V Lowry
Age	N/A
Person	5353 US Highway 223, Adrian, MI 49221

Roger S Lowry

Name / Names	Roger S Lowry
Age	N/A
Person	7889 E DE AVE, RICHLAND, MI 49083
Phone Number	269-629-4372

Roger L Lowry

Name / Names	Roger L Lowry
Age	N/A
Person	13894 N SHORE DR, MILLERSBURG, MI 49759
Phone Number	989-733-2843

Roger P Lowry

Name / Names	Roger P Lowry
Age	N/A
Person	216 ANDERSON PL, BUFFALO, NY 14222
Phone Number	716-884-0674

Roger S Lowry

Name / Names	Roger S Lowry
Age	N/A
Person	3614 N 60TH AVE, PHOENIX, AZ 85033
Phone Number	623-247-0405

Roger C Lowry

Name / Names	Roger C Lowry
Age	N/A
Person	40 RUTLEDGE ST, BRENTWOOD, NY 11717
Phone Number	631-273-2698

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	701 Clay, Hoisington, KS 67544
Possible Relatives	Susan D Lowry Bill Lowry

Roger W Lowry

Name / Names	Roger W Lowry
Age	N/A
Person	3672 Spring, Chamblee, GA 30341
Possible Relatives	Shirley Berry Lowry Michael B Lowry

Roger E Lowry

Name / Names	Roger E Lowry
Age	N/A
Person	4051 BEELER RD, LIMA, OH 45806
Phone Number	419-991-0619

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	846 County Road 458, Lexington, AL 35648
Possible Relatives	Darlene L Lowry

Roger S Lowry

Name / Names	Roger S Lowry
Age	N/A
Person	6411 Country Club Ct, Hyattsville, MD 20785
Possible Relatives	Maxine Lowry

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	2711 S 135TH EAST AVE, TULSA, OK 74134
Phone Number	918-438-6238

Roger K Lowry

Name / Names	Roger K Lowry
Age	N/A
Person	1709 LEE LN, PLEASANT HILL, MO 64080
Phone Number	816-540-2650

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	604 BOB WHITE RD, WAYNE, PA 19087

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	9756 Greenridge Heights, Fairview Hts, IL 62208

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	9756 Greenridge Heights, East Saint Louis, IL 62208

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	601 Pennsylvania, Washington, DC 20004

Roger J Lowry

Name / Names	Roger J Lowry
Age	N/A
Person	7549 Knoll, Jacksonville, FL 32221
Possible Relatives	Janet K Lowry
Associated Business	WEAPONS CORPORATION OF FLORIDA, INC

Roger H Lowry

Name / Names	Roger H Lowry
Age	N/A
Person	1717 ENVY LN, LONGVIEW, TX 75604
Phone Number	903-234-8990

Roger R Lowry

Name / Names	Roger R Lowry
Age	N/A
Person	229 RIVER FORD DR, MARYVILLE, TN 37804
Phone Number	865-983-2322

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	186 STROPS RD, WAVERLY, NY 14892
Phone Number	607-565-3091

Roger A Lowry

Name / Names	Roger A Lowry
Age	N/A
Person	124 LIGE CT, NICHOLASVILLE, KY 40356

Roger Lowry

Name / Names	Roger Lowry
Age	N/A
Person	5146 CRAIGMONT DR, MEMPHIS, TN 38134

Business Registrations Data for Roger Lowry - 6 records

Roger Lowry

Business Name	Save-A-Lot
Person Name	Roger Lowry
Position	company contact
State	KY
Address	1428 Broadway St Paducah KY 42001-2506
Industry	Food Stores (Food)
SIC Code	5411
SIC Description	Grocery Stores
Phone Number	270-442-6918
Number Of Employees	23
Annual Revenue	3749200
Fax Number	270-442-0117

Roger Lowry

Business Name	Roger Lowry Motors Inc
Person Name	Roger Lowry
Position	company contact
State	AL
Address	P.O. BOX 370 Orrville AL 36767-0370
Industry	Gasoline Service Stations and Automotive Dealers (Automotive)
SIC Code	5521
SIC Description	Used Car Dealers
Phone Number	256-593-9398
Number Of Employees	4
Annual Revenue	530400

Roger Lowry

Business Name	Mills Beverages & Wine
Person Name	Roger Lowry
Position	company contact
State	AL
Address	8897 Highway 72 W Madison AL 35758-9588
Industry	Miscellaneous Retail (Stores)
SIC Code	5921
SIC Description	Liquor Stores
Phone Number	256-837-8609
Number Of Employees	4
Annual Revenue	353430

Roger Lowry

Business Name	Lowry Financial & Retire Svc
Person Name	Roger Lowry
Position	company contact
State	CO
Address	2954 E 108th Dr Northglenn CO 80233-4617
Industry	Commodity and Security Brokers, Exchanges, Services and Dealers (Finance)
SIC Code	6282
SIC Description	Investment Advice
Phone Number	303-450-8107
Number Of Employees	2
Annual Revenue	821700

Roger Lowry

Business Name	Lowry Brothers Hardware & Farm
Person Name	Roger Lowry
Position	company contact
State	IN
Address	201 S Washington St Reynolds IN 47980-0000
Industry	Mobile Home Dealers, Garden Supply, Building Materials and Hardware (Construction)
SIC Code	5251
SIC Description	Hardware Stores
Phone Number	219-984-5333
Number Of Employees	9
Annual Revenue	797220
Fax Number	219-984-5334

Roger Lowry

Business Name	Lowery and Assoc
Person Name	Roger Lowry
Position	company contact
State	NE
Address	P.O. BOX 6 York NE 68467-0006
Industry	Insurance Brokers, Agents and Services (Insurance)
SIC Code	6411
SIC Description	Insurance Agents, Brokers, And Service
Phone Number	402-362-3850

Employment and Salary for Roger Lowry - 17 records

Lowry Roger

State	KS
Calendar Year	2018
Employer	Otis-Bison
Name	Lowry Roger
Annual Wage	$30,964

Lowry Roger B

State	CO
Calendar Year	2018
Employer	Dept Of Public Safety
Job Title	State Patrol Trooper
Name	Lowry Roger B
Annual Wage	$77,476

Lowry Roger L

State	GA
Calendar Year	2010
Employer	Gwinnett County Board Of Education
Job Title	Security Personnel/security Officer
Name	Lowry Roger L
Annual Wage	$24,698

Lowry Roger L

State	GA
Calendar Year	2011
Employer	Gwinnett County Board Of Education
Job Title	Security Personnel/security Officer
Name	Lowry Roger L
Annual Wage	$20,568

Lowry Roger L

State	GA
Calendar Year	2012
Employer	Gwinnett County Board Of Education
Job Title	Security Personnel/security Officer
Name	Lowry Roger L
Annual Wage	$20,884

Lowry Roger L

State	GA
Calendar Year	2013
Employer	Gwinnett County Board Of Education
Job Title	School Secretary/clerk
Name	Lowry Roger L
Annual Wage	$19,890

Lowry Roger L

State	GA
Calendar Year	2014
Employer	Gwinnett County Board Of Education
Job Title	School Secretary/clerk
Name	Lowry Roger L
Annual Wage	$20,172

Lowry Roger B

State	CO
Calendar Year	2018
Employer	Dept Of Public Safety
Job Title	State Patrol Cadet
Name	Lowry Roger B
Annual Wage	$77,476

Lowry Roger L

State	GA
Calendar Year	2015
Employer	Gwinnett County Board Of Education
Job Title	School Secretary/clerk
Name	Lowry Roger L
Annual Wage	$20,290

Lowry Roger L

State	GA
Calendar Year	2017
Employer	Gwinnett County Board Of Education
Job Title	School Secretary/Clerk
Name	Lowry Roger L
Annual Wage	$21,176

Lowry Roger L

State	GA
Calendar Year	2018
Employer	Gwinnett County Board Of Education
Job Title	Security Personnel/Security Officer
Name	Lowry Roger L
Annual Wage	$15,269

Lowry Roger

State	KS
Calendar Year	2015
Employer	Hoisington
Name	Lowry Roger
Annual Wage	$96,490

Lowry Roger

State	KS
Calendar Year	2016
Employer	Hoisington
Name	Lowry Roger
Annual Wage	$98,904

Lowry Roger

State	KS
Calendar Year	2017
Employer	Hoisington
Name	Lowry Roger
Annual Wage	$59,963

Lowry Roger

State	KS
Calendar Year	2018
Employer	Hoisington
Name	Lowry Roger
Annual Wage	$59,972

Lowry Roger L

State	GA
Calendar Year	2016
Employer	Gwinnett County Board Of Education
Job Title	School Secretary/clerk
Name	Lowry Roger L
Annual Wage	$20,937

Lowry Roger B

State	CO
Calendar Year	2017
Employer	Public Safety
Job Title	State Patrol Cadet
Name	Lowry Roger B
Annual Wage	$32,520

Marketing Data for Roger Lowry - 28 records

Roger Lowry

Name	Roger Lowry
Address	1299 S Hospital Rd Waterford MI 48327 -4041
Phone Number	248-756-3401
Telephone Number	248-756-3401
Mobile Phone	248-756-3401
Email	[email protected]
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$55,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	3
Range Of New Credit	1001
Education	Completed High School
Language	English

Roger J Lowry

Name	Roger J Lowry
Address	2954 E 108th Dr Denver CO 80233 -4617
Phone Number	303-254-7663
Gender	Male
Date Of Birth	1946-01-06
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$100,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	4
Range Of New Credit	Greater than $9,999
Education	Completed Graduate School
Language	English

Roger L Lowry

Name	Roger L Lowry
Address	PO Box 873 Lovell WY 82431-0873 -0873
Phone Number	307-548-2335
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$30,000
Estimated Net Worth	$50,000
Lines Of Credit Trade Counter	2
Range Of New Credit	Greater than $9,999
Education	Completed Graduate School
Language	English

Roger E Lowry

Name	Roger E Lowry
Address	155 Longview Ct Saint Marys OH 45885 -1140
Phone Number	419-300-8860
Gender	Male
Date Of Birth	1940-02-12
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$35,000
Estimated Net Worth	$250,000
Range Of New Credit	1001
Education	Completed High School
Language	English

Roger D Lowry

Name	Roger D Lowry
Address	16131 Janet Dr Amelia Court House VA 23002 -4515
Phone Number	434-292-2868
Gender	Male
Date Of Birth	1964-09-16
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$100,000
Estimated Net Worth	$5,000
Range Of New Credit	1001
Education	Completed High School
Language	English

Roger S Lowry

Name	Roger S Lowry
Address	8418 W Willowbrook Dr Peoria AZ 85382 -0895
Phone Number	602-363-8310
Email	[email protected]
Gender	Male
Date Of Birth	1956-01-01
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$75,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	1
Range Of New Credit	501
Education	Completed Graduate School
Language	English

Roger Lowry

Name	Roger Lowry
Address	186 Strops Rd Waverly NY 14892 -9809
Phone Number	607-565-3091
Telephone Number	607-731-7962
Mobile Phone	607-731-7962
Email	[email protected]
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$50,000
Estimated Net Worth	$25,000
Lines Of Credit Trade Counter	1
Range Of New Credit	5001
Education	Completed High School
Language	English

Roger Lowry

Name	Roger Lowry
Address	604 Bob White Rd Wayne PA 19087 -2305
Phone Number	610-971-2228
Email	[email protected]
Gender	Male
Date Of Birth	1966-04-01
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$65,000
Estimated Net Worth	$250,000
Lines Of Credit Trade Counter	1
Range Of New Credit	1001
Education	Completed College
Language	English

Roger Lowry

Name	Roger Lowry
Address	112 Acton Ct Delaware OH 43015 -4095
Phone Number	614-313-3627
Email	[email protected]
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$60,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	2
Range Of New Credit	1001
Education	Completed High School
Language	English

Roger D Lowry

Name	Roger D Lowry
Address	9756 Greenridge Heights Rd Fairview Heights IL 62208 -2302
Phone Number	618-397-3082
Gender	Male
Date Of Birth	1960-06-12
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$45,000
Estimated Net Worth	$50,000
Education	Completed College
Language	English

Roger O Lowry

Name	Roger O Lowry
Address	516 Jeffrey Pine Ct O Fallon IL 62269 -2553
Phone Number	618-628-7110
Gender	Male
Date Of Birth	1956-01-24
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$100,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	2
Education	Completed Graduate School
Language	English

Roger W Lowry

Name	Roger W Lowry
Address	302 N Green St Hoisington KS 67544 -2244
Phone Number	620-292-7073
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Range Of New Credit	3001
Education	Completed High School
Language	English

Roger Lowry

Name	Roger Lowry
Address	15101 Woodsbluff Dr Chesterfield MO 63017 -7758
Phone Number	636-519-0380
Email	[email protected]
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$250,000
Estimated Net Worth	$250,000
Lines Of Credit Trade Counter	1
Range Of New Credit	3001
Education	Completed High School
Language	English

Roger V Lowry

Name	Roger V Lowry
Address	707 Norwood Ter Lake Saint Louis MO 63367 -1472
Phone Number	636-561-0318
Telephone Number	314-308-6959
Mobile Phone	314-308-6959
Email	[email protected]
Gender	Male
Date Of Birth	1947-04-11
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$75,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	1
Range Of New Credit	Greater than $9,999
Education	Completed Graduate School
Language	English

Roger T Lowry

Name	Roger T Lowry
Address	216 Anderson Pl Buffalo NY 14222 APT 1-1804
Phone Number	716-884-0674
Gender	Male
Date Of Birth	1956-05-06
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$50,000
Estimated Net Worth	$50,000
Lines Of Credit Trade Counter	1
Range Of New Credit	1001
Education	Completed College
Language	English

Roger L Lowry

Name	Roger L Lowry
Address	464 Bell Grove Rd Ohiopyle PA 15470 -1212
Phone Number	724-329-4618
Gender	Male
Date Of Birth	1952-06-24
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$30,000
Estimated Net Worth	$50,000
Lines Of Credit Trade Counter	1
Range Of New Credit	Greater than $9,999
Education	Completed College
Language	English

Roger L Lowry

Name	Roger L Lowry
Address	4858 Rosemoore Ct Suwanee GA 30024 -3058
Phone Number	770-271-7967
Mobile Phone	770-377-4258
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$100,000
Estimated Net Worth	$250,000
Lines Of Credit Trade Counter	4
Education	Completed Graduate School
Language	English

Roger K Lowry

Name	Roger K Lowry
Address	1709 Lee Ln Pleasant Hill MO 64080 -1143
Phone Number	816-540-2650
Email	[email protected]
Gender	Male
Date Of Birth	1949-12-26
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$60,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	1
Range Of New Credit	5001
Education	Completed High School
Language	English

Roger A Lowry

Name	Roger A Lowry
Address	124 Lige Ct Nicholasville KY 40356 -2210
Phone Number	859-881-0895
Email	[email protected]
Gender	Male
Date Of Birth	1950-10-27
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$50,000
Estimated Net Worth	$50,000
Lines Of Credit Trade Counter	5
Range Of New Credit	1001
Education	Completed College
Language	English

Roger D Lowry

Name	Roger D Lowry
Address	11028 Ne 1st Way Okeechobee FL 34972 -8303
Phone Number	863-357-2148
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$65,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	5
Range Of New Credit	3001
Education	Completed High School
Language	English

Roger R Lowry

Name	Roger R Lowry
Address	229 River Ford Dr Maryville TN 37804 -3906
Phone Number	865-983-2322
Gender	Male
Date Of Birth	1973-09-10
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$60,000
Estimated Net Worth	$100,000
Lines Of Credit Trade Counter	1
Range Of New Credit	5001
Education	Completed High School
Language	English

Roger H Lowry

Name	Roger H Lowry
Address	1717 Envy Ln Longview TX 75604 -4422
Phone Number	903-234-8990
Email	[email protected]
Gender	Male
Date Of Birth	1946-07-08
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$50,000
Estimated Net Worth	$25,000
Lines Of Credit Trade Counter	1
Range Of New Credit	1001
Education	Completed High School
Language	English

Roger D Lowry

Name	Roger D Lowry
Address	4652 S Saint Louis Ave Tulsa OK 74105 -4818
Phone Number	918-712-9872
Gender	Male
Date Of Birth	1956-07-16
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$50,000
Estimated Net Worth	$50,000
Lines Of Credit Trade Counter	3
Range Of New Credit	101
Education	Completed College
Language	English

Roger L Lowry

Name	Roger L Lowry
Address	555 Ridgewood Dr Manchester TN 37355 -6074
Phone Number	931-728-1880
Mobile Phone	931-334-1081
Gender	Male
Date Of Birth	1941-06-07
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$25,000
Estimated Net Worth	$250,000
Lines Of Credit Trade Counter	4
Range Of New Credit	1001
Education	Completed High School
Language	English

Roger B Lowry

Name	Roger B Lowry
Address	24742 Cedar Mesa Rd Cedaredge CO 81413 -5204
Phone Number	970-618-0406
Email	[email protected]
Gender	Male
Date Of Birth	1940-03-10
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$55,000
Estimated Net Worth	$250,000
Education	Completed High School
Language	English

Roger A Lowry

Name	Roger A Lowry
Address	Po Box 543 Dove Creek CO 81324 -0543
Phone Number	970-677-2808
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$30,000
Estimated Net Worth	$50,000
Education	Completed Graduate School
Language	English

Roger Lowry

Name	Roger Lowry
Address	1608 Chateau Ln Mansfield TX 76063 -6287
Phone Number	972-533-3164
Email	[email protected]
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$75,000
Estimated Net Worth	$25,000
Range Of New Credit	1001
Education	Completed High School
Language	English

Roger L Lowry

Name	Roger L Lowry
Address	13894 N Shore Dr Millersburg MI 49759 -9734
Phone Number	989-733-2843
Gender	Male
Ethnicity	English
Ethnic Group	Western European
Estimated Household Income	$50,000
Estimated Net Worth	$1
Range Of New Credit	Greater than $9,999
Education	Completed Graduate School
Language	English

Property Data for Roger Lowry - 4 records

ROGER W LOWRY & MARGARET ALLISON LOWRY

Name	ROGER W LOWRY & MARGARET ALLISON LOWRY
Address	105 Middlebrooke Court Canton GA 30115
Numberofbathrooms	2
Bedrooms	4
Numberofbedrooms	4

ROGER S/RHONDA F LOWRY

Name	ROGER S/RHONDA F LOWRY
Address	8418 Willowbrook Drive Peoria AZ 85382
Value	30200
Landvalue	30200

ROGER S/RHONDA F LOWRY

Name	ROGER S/RHONDA F LOWRY
Address	14922 Caribbean Lane Surprise AZ 85379
Value	15100
Landvalue	15100

LOWRY ROGER & DEBBIE

Name	LOWRY ROGER & DEBBIE
Physical Address	11028 NE 1ST WAY, OKEECHOBEE, FL 34972
Owner Address	11028 NORTHEAST 1ST WAY, OKEECHOBEE, FL 34974
Ass Value Homestead	22965
Just Value Homestead	22965
County	Okeechobee
Year Built	1966
Area	4241
Applicant Status	Husband
Co Applicant Status	Wife
Land Code	Multi-family - less than 10 units
Address	11028 NE 1ST WAY, OKEECHOBEE, FL 34972

Voter Registrations for Roger Lowry - 4 records

ROGER LOWRY

Name	ROGER LOWRY
Type	Voter
State	NC
Address	2255 COVEY LN SW, SUPPLY, NC 28462
Phone Number	910-842-7384
Email Address	[email protected]

ROGER LOWRY

Name	ROGER LOWRY
Type	Voter
State	WA
Address	PO BOX 1162, VERADALE, WA 99037
Phone Number	509-389-4163
Email Address	[email protected]

ROGER LOWRY

Name	ROGER LOWRY
Type	Independent Voter
State	WA
Address	9305 SOUTH SPOTTED ROAD, CHENEY, WA 99004
Phone Number	509-389-4163
Email Address	[email protected]

ROGER LOWRY

Name	ROGER LOWRY
Type	Independent Voter
State	MO
Address	707 NORWOOD TER, LAKE SAINT LOUIS, MO 63367
Phone Number	314-308-6959
Email Address	[email protected]

Vehicle Sales Records for Roger Lowry - 10 records

ROGER LOWRY

Name	ROGER LOWRY
Car	CHEVROLET MALIBU
Year	2012
Address	PO Box 873, Lovell, WY 82431-0873
Vin	1G1ZB5E02CF192927
Phone	307-548-2335

ROGER LOWRY

Name	ROGER LOWRY
Car	BUICK REGAL
Year	2011
Address	4858 Rosemoore Ct, Suwanee, GA 30024-3058
Vin	W04GS5EC2B1054982
Phone	770-963-8041

ROGER LOWRY

Name	ROGER LOWRY
Car	NISSAN MAXIMA
Year	2010
Address	1608 Chateau Ln, Mansfield, TX 76063-6287
Vin	1N4AA5AP2AC833346

ROGER LOWRY

Name	ROGER LOWRY
Car	CHEVROLET MALIBU
Year	2010
Address	112 Acton Ct, Delaware, OH 43015-4095
Vin	1G1ZC5EB8AF109092

ROGER LOWRY

Name	ROGER LOWRY
Car	FORD F-250 SUPER DUTY
Year	2009
Address	16131 Janet Dr, Amelia Court House, VA 23002-4515
Vin	1FTSX21579EB23434
Phone	434-294-1325

ROGER LOWRY

Name	ROGER LOWRY
Car	BUICK ENCLAVE
Year	2009
Address	302 N Green St, Hoisington, KS 67544-2244
Vin	5GAER13D49J171777

ROGER LOWRY

Name	ROGER LOWRY
Car	CHEVROLET MALIBU
Year	2009
Address	1299 S HOSPITAL RD, WATERFORD, MI 48327-4041
Vin	1G1ZJ577394169027

ROGER LOWRY

Name	ROGER LOWRY
Car	DODGE RAM 3500
Year	2008
Address	464 Bell Grove Rd, Ohiopyle, PA 15470-1212
Vin	3D7MX48A78G162691
Phone	724-329-4618

ROGER LOWRY

Name	ROGER LOWRY
Car	HUMMER HUMMER
Year	2008
Address	19914 FORT DAVIS CT, KATY, TX 77449-3306
Vin	5GTEN13E888110207

ROGER LOWRY

Name	ROGER LOWRY
Car	FORD F-150
Year	2008
Address	1299 S Hospital Rd, Waterford, MI 48327-4041
Vin	1FTPW14VX8FB75342

Whois Records for Roger Lowry - 10 records

Roger Lowry

Name	Roger Lowry
Domain	3dultrasoundofhouston.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2012-02-21
Update Date	2013-02-22
Registrar Name	GODADDY.COM, LLC
Registrant Address	3907 Crystal Pass Ct Katy Texas 77449
Registrant Country	UNITED STATES

Roger Lowry

Name	Roger Lowry
Domain	3dultrasoundsofkaty.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2012-02-21
Update Date	2013-02-22
Registrar Name	GODADDY.COM, LLC
Registrant Address	3907 Crystal Pass Ct Katy Texas 77449
Registrant Country	UNITED STATES

Roger Lowry

Name	Roger Lowry
Domain	3dultrasoundofkaty.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2012-02-21
Update Date	2013-02-22
Registrar Name	GODADDY.COM, LLC
Registrant Address	3907 Crystal Pass Ct Katy Texas 77449
Registrant Country	UNITED STATES

Roger Lowry

Name	Roger Lowry
Domain	3dultrasoundsofhouston.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2012-02-21
Update Date	2013-02-22
Registrar Name	GODADDY.COM, LLC
Registrant Address	3907 Crystal Pass Ct Katy Texas 77449
Registrant Country	UNITED STATES

Roger Lowry

Name	Roger Lowry
Domain	3dultrasoundhouston.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2012-02-21
Update Date	2013-02-22
Registrar Name	GODADDY.COM, LLC
Registrant Address	3907 Crystal Pass Ct Katy Texas 77449
Registrant Country	UNITED STATES

Roger Lowry

Name	Roger Lowry
Domain	houstonalwayshome.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2009-07-07
Update Date	2013-05-13
Registrar Name	GODADDY.COM, LLC
Registrant Address	24624 Roesner Katy Texas 77494
Registrant Country	UNITED STATES

Roger Lowry

Name	Roger Lowry
Domain	lowrysoutdoorservices.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2012-07-18
Update Date	2012-07-18
Registrar Name	GODADDY.COM, LLC
Registrant Address	136 Waterly Waterford Michigan 48328
Registrant Country	UNITED STATES

Roger Lowry

Name	Roger Lowry
Domain	4dultrasoundhouston.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2012-02-21
Update Date	2013-02-22
Registrar Name	GODADDY.COM, LLC
Registrant Address	3907 Crystal Pass Ct Katy Texas 77449
Registrant Country	UNITED STATES

Roger Lowry

Name	Roger Lowry
Domain	katybouncehouses.com
Contact Email	[email protected]
Whois Sever	whois.godaddy.com
Create Date	2013-02-24
Update Date	2013-02-24
Registrar Name	GODADDY.COM, LLC
Registrant Address	3907 Crystal Pass Ct Katy Texas 77449
Registrant Country	UNITED STATES

Lowry, Roger

Name	Lowry, Roger
Domain	lowryfinancialretirementservices.com
Contact Email	[email protected]
Whois Sever	whois.networksolutions.com
Create Date	2012-10-12
Update Date	2012-10-12
Registrar Name	NETWORK SOLUTIONS, LLC.
Registrant Address	2954 East 108th Drive Northglenn CO 80233
Registrant Country	UNITED STATES