We have found 117 public records related to Ray Moss in 28 states . People found have 2 ethnicities: African American 1 and English. Education levels of people we have found are: Completed College, Completed Graduate School and Completed High School. All people found speak English language. There are 16 business registration records connected with Ray Moss in public records. The businesses are registered in 9 different states. Most of the businesses are registered in Georgia state. The businesses are engaged in 9 different industries. Most of the businesses are engaged in Social Services (Services) industry. There are 5 profiles of government employees in our database. All people found job title is Temporary Faculty Credit. These employees work in 2 states: AK and AL. Average wage of employees is $51,049.
| Name / Names | Ray Moss |
|---|---|
| Age | 68 |
| Birth Date | 1956 |
| Person | 10358 Gibbs Ave, Rosedale, IN 47874 |
| Phone Number | 812-877-1618 |
| Possible Relatives |
Donna K Moss Brandy K Moss Gary R Moss |
| Previous Address |
231 PO Box, Rosedale, IN 47874 231 RR 2 #231, Rosedale, IN 47874 |
| Name / Names | Ray E Moss |
|---|---|
| Age | 68 |
| Birth Date | 1956 |
| Also Known As | R Moss |
| Person | 1536 Liberty Ln, Gallatin, TN 37066 |
| Phone Number | 901-872-3178 |
| Possible Relatives |
Sharon K Moss Joshua K Moss Austin J Moss |
| Previous Address |
701 Interstate 30, Rockwall, TX 75087 9224 Quito Rd #7, Millington, TN 38053 1023 Signal Ridge Pl, Rockwall, TX 75032 3210 Cedar Ridge Rd, Nashville, TN 37214 1405 Woodchimes Ct, Hermitage, TN 37076 224 Deerpoint Ct, Hendersonville, TN 37075 716 Main St, Madisonville, TX 77864 |
| Name / Names | Ray A Moss |
|---|---|
| Age | 71 |
| Birth Date | 1953 |
| Person | 2087 Woodsong Way, Fountain, CO 80817 |
| Phone Number | 719-382-7352 |
| Possible Relatives |
Julie A Moss Jason Allen Moss Justin Kendall Moss Allen Moss Al Moss |
| Previous Address |
219 Ray St, Brush, CO 80723 82333rd, Denver, CO 80206 7 82333rd #1, Denver, CO 80206 3007 Mobile Way, Aurora, CO 80013 |
| [email protected] |
| Name / Names | Ray Gene Moss |
|---|---|
| Age | 74 |
| Birth Date | 1950 |
| Also Known As | R Moss |
| Person | 160 Moss Ln, Weatherford, TX 76088 |
| Phone Number | 817-613-9539 |
| Possible Relatives |
Sandra Brown Moss Lisa Kay Hicks Michael Ray Moss Lisa K Moss |
| Previous Address |
610 Baylor St, Weatherford, TX 76086 825 Moss Ln, Weatherford, TX 76088 412 Josephine St, Weatherford, TX 76086 1317 Sweet Springs Rd, Weatherford, TX 76088 220 Harmon St, Weatherford, TX 76086 921 Terry Trl, Weatherford, TX 76086 |
| Associated Business | Ray Moss Greenwood Community Center, Inc |
| Name / Names | Ray Bruce Moss |
|---|---|
| Age | 75 |
| Birth Date | 1949 |
| Person | 6221 Taylor Rd, Mission, TX 78573 |
| Phone Number | 956-581-2965 |
| Possible Relatives |
Gloria Salinas Salinas Wesley Rhodes Moss Kay B Moss Rhodie Moss |
| Previous Address |
6709 Taylor Rd, Mission, TX 78574 6221 Taylor Rd, Mission, TX 78574 RR 1, Mission, TX 78574 Taylor Rd, Mission, TX 78573 156 RR 1, Mission, TX 78574 3570 RR 1, Mission, TX 78574 3570 PO Box, Mission, TX 78573 Taylor Rd, Mission, TX 78572 Route 1 A Badger, Mission, TX 78572 314 7th St, Mcallen, TX 78501 156A PO Box, Mission, TX 78573 |
| Name / Names | Ray H Moss |
|---|---|
| Age | 79 |
| Birth Date | 1945 |
| Person | 1555 Bryden Rd #520, Columbus, OH 43205 |
| Phone Number | 614-236-4824 |
| Possible Relatives |
Carol S Mossbailey Joyce M Cherry Robert L Moss Carolyn F Roberts Andrew P Moss Emma M Mossalfred David A Moss Keith T Moss Raymond H Moss |
| Previous Address |
1555 Bryden Rd, Columbus, OH 43205 1555 Bryden Rd #421, Columbus, OH 43205 1555 Bryden Rd #523, Columbus, OH 43205 290 Champion Ave #C, Columbus, OH 43203 1356 Champion Ave, Columbus, OH 43206 120 Hampton Rd #D, Columbus, OH 43213 518 Town St #315, Columbus, OH 43215 45 Governor Beaver Sprngfd, Columbus, OH 43203 45 Governors Pl, Columbus, OH 43203 |
| [email protected] |
| Name / Names | Ray Franklin Moss |
|---|---|
| Age | 82 |
| Birth Date | 1942 |
| Also Known As | Ray R Moss |
| Person | 401 Franklinville St, Staley, NC 27355 |
| Phone Number | 336-622-5642 |
| Possible Relatives | Dorothy Gouge Moss |
| Previous Address |
165 PO Box, Staley, NC 27355 221 RR 1 #221, Staley, NC 27355 221 PO Box, Staley, NC 27355 407 Franklinville St, Staley, NC 27355 RR 1 POB 221GG, Staley, NC 27355 |
| [email protected] |
| Name / Names | Ray Moss |
|---|---|
| Age | 85 |
| Birth Date | 1938 |
| Person | 5181 Agricola Latonia Rd, Lucedale, MS 39452 |
| Phone Number | 601-947-2501 |
| Possible Relatives |
Luena W Moss Raymond Moss Luena W Moss |
| Previous Address |
5138 Agricola Latonia Rd, Lucedale, MS 39452 303 RR 8, Lucedale, MS 39452 302 RR 8, Lucedale, MS 39452 5163 Agricola Latonia Rd, Lucedale, MS 39452 Agricola Latonia Rd, Lucedale, MS 39452 Agricola-L Rd, Lucedale, MS 39452 6524 Shortcut Rd, Moss Point, MS 39563 RR 8, Lucedale, MS 39452 Agricola-Latonia Rd, Lucedale, MS 39452 303 PO Box, Lucedale, MS 39452 302A PO Box, Lucedale, MS 39452 302A RR 8, Lucedale, MS 39452 |
| Name / Names | Ray D Moss |
|---|---|
| Age | 87 |
| Birth Date | 1936 |
| Person | 411 Kentucky Ave, Tipton, IN 46072 |
| Phone Number | 765-675-7980 |
| Possible Relatives |
Delbert R Moss Patricia I Moss Kay Alan Moss Randy J Moss |
| Previous Address | 321 Washington St, Tipton, IN 46072 |
| Name / Names | Ray Loyd Moss |
|---|---|
| Age | 87 |
| Birth Date | 1936 |
| Person | 2661 Val Vista Dr, Mesa, AZ 85213 |
| Phone Number | 480-854-1800 |
| Possible Relatives | Lois L Moss |
| Previous Address |
1879 Stonebridge, Heber, AZ 85928 1433 Shellfish Dr, Gilbert, AZ 85233 1859 Val Vista Dr, Mesa, AZ 85213 890 Coral Key Ave, Gilbert, AZ 85233 2255 Val Vista Dr, Mesa, AZ 85213 1434 Key Harbor Dr, Gilbert, AZ 85233 810 Orchard, Mesa, AZ 85213 2215 Val Vista Dr, Mesa, AZ 85213 2725 Hope St, Mesa, AZ 85213 |
| Name / Names | Ray L Moss |
|---|---|
| Age | 88 |
| Birth Date | 1935 |
| Also Known As | Rae L Moss |
| Person | 5100 Convent Ln #212, Philadelphia, PA 19114 |
| Phone Number | 215-632-7194 |
| Possible Relatives | Theodore L Moss |
| Previous Address |
5100 Convent Ln #506, Philadelphia, PA 19114 5100 Convent Ln, Philadelphia, PA 19114 15095 Thompson Peak Pkwy #2027, Scottsdale, AZ 85260 5100 Convent Ln #212E, Philadelphia, PA 19114 5100 Convent Ln #515, Philadelphia, PA 19114 5100 Convent Ln #208, Philadelphia, PA 19114 71203 Delaire Landing Rd #203, Philadelphia, PA 19114 2237 Brighton St, Philadelphia, PA 19149 1615 McNelis Dr, Southampton, PA 18966 1500 Convent Ln #212E, Philadelphia, PA 19114 Delaire Lndg, Philadelphia, PA 19114 3115 Sanshaw, Phila, PA 00000 |
| Name / Names | Ray C Moss |
|---|---|
| Age | 90 |
| Birth Date | 1933 |
| Person | 512 Barberry Ln, Nicholasville, KY 40356 |
| Phone Number | 859-885-6256 |
| Possible Relatives |
Sara Y Moss Cecile R Moss Irene E Moss Amy J Moss |
| Name / Names | Ray W Moss |
|---|---|
| Age | 92 |
| Birth Date | 1931 |
| Also Known As | R Moss |
| Person | 1623 Hislop Dr, Ogden, UT 84404 |
| Phone Number | 801-621-4075 |
| Possible Relatives |
Susan M Smithmossco Joyce Elaine Moss Kerry Ray Moss Debra Ruth Moss |
| Previous Address |
12666 PO Box, Ogden, UT 84412 3909 Airport Rd #222, Ogden, UT 84405 2457 Po, Ogden, UT 84409 |
| Associated Business | Ramco Industries, Inc Common Cents Software, Inc Conval-Aid Health Care, Inc Ramco Management Company Ramco Realty |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 2042 Downs Pl, Lithonia, GA 30058 |
| Possible Relatives |
Roy Ill Moss Mary J Thomas Iii Roy Moss |
| Previous Address | 2108 Treehouse Pkwy #2108, Norcross, GA 30093 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 118 100, Jerome, ID 83338 |
| Phone Number | 208-324-2039 |
| Possible Relatives |
Petersen Joyce Moss Jed Moss Joyce B Moss |
| Previous Address |
136 Seminole Cir, Jerome, ID 83338 3978 RR 3 POB, Jerome, ID 83338 3987 RR 3 POB, Jerome, ID 83338 118 S #1, Jerome, ID 83338 |
| Name / Names | Ray R Moss |
|---|---|
| Age | N/A |
| Person | 201 PO Box, Rohwer, AR 71666 |
| Phone Number | 870-382-5482 |
| Possible Relatives | Tonya Ann Moss |
| Previous Address | 37 Mistletoe St, Dumas, AR 71639 |
| Name / Names | Ray L Moss |
|---|---|
| Age | N/A |
| Person | 2661 N VAL VISTA DR, MESA, AZ 85213 |
| Phone Number | 480-854-1800 |
| Name / Names | Ray A Moss |
|---|---|
| Age | N/A |
| Person | 2087 WOODSONG WAY, FOUNTAIN, CO 80817 |
| Phone Number | 719-382-7352 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 171284 PO Box, Salt Lake City, UT 84117 |
| Possible Relatives |
Jed Trust Moss Jeanne S Moss Jennifer E Outrammoss Jennie Moss Joyce B Moss |
| Previous Address |
1890 Woodside Dr, Salt Lake City, UT 84124 1045 Hollywood Ave, Salt Lake City, UT 84105 1815 Stratford Ave, Salt Lake City, UT 84106 1855 4650, Salt Lake City, UT 84117 |
| Name / Names | Ray W Moss |
|---|---|
| Age | N/A |
| Person | PO Box, Driggs, ID 83422 |
| Possible Relatives |
Lane Francis Moss Kristin L Moss |
| Previous Address |
3450 Po #3450, Driggs, ID 83422 3450 PO Box, Driggs, ID 83422 3450 RR 1 POB, Driggs, ID 83422 1 1 RR 1, Driggs, ID 83422 1 RR 1 #3450, Driggs, ID 83422 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 300 Valley Dr, Pontotoc, MS 38863 |
| Possible Relatives |
Vera Denise Moss James Chris Moss Beverly Aneice Moss Jeffery W Moss |
| Previous Address | 16 PO Box, Pontotoc, MS 38863 |
| Name / Names | Ray A Moss |
|---|---|
| Age | N/A |
| Person | 2087 WOODSONG WAY, FOUNTAIN, CO 80817 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 1422 MILLERS MILL RD, STOCKBRIDGE, GA 30281 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 212 VIA MILAN TER, DAVIE, FL 33325 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 212 PO Box, Rohwer, AR 71666 |
| Name / Names | Ray F Moss |
|---|---|
| Age | N/A |
| Person | 3241 Calumet Dr, Raleigh, NC 27610 |
| Name / Names | Ray E Moss |
|---|---|
| Age | N/A |
| Person | 104 MILL POND RD, ROSWELL, GA 30076 |
| Phone Number | 770-992-9686 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 4386 WHIPORWILL RD, GILLSVILLE, GA 30543 |
| Phone Number | 770-869-0200 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 5030 E 13TH ST, PANAMA CITY, FL 32404 |
| Phone Number | 850-763-4887 |
| Name / Names | Ray W Moss |
|---|---|
| Age | N/A |
| Person | 1543 12th St, Ogden, UT 84404 |
| Phone Number | 801-392-0302 |
| Possible Relatives |
Angela Jo Stock Joyce Elaine Moss Kerry Ray Moss Debra Ruth Moss Kelly Ray Moss |
| Name / Names | Ray J Moss |
|---|---|
| Age | N/A |
| Person | 17835 SE 104TH TER, SUMMERFIELD, FL 34491 |
| Phone Number | 352-245-0851 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 10950 W UNION HILLS DR, SUN CITY, AZ 85373 |
| Phone Number | 623-977-7865 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 7750 WIND SONG DR, TRUSSVILLE, AL 35173 |
| Phone Number | 205-655-1110 |
| Name / Names | Ray J Moss |
|---|---|
| Age | N/A |
| Person | 9244 WIND CLAN TRL, DAPHNE, AL 36526 |
| Phone Number | 251-626-5778 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 703 CHESTNUT ST, ONEONTA, AL 35121 |
| Phone Number | 205-274-7183 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 1080 Dawsonville Hwy, Gainesville, GA 30501 |
| Possible Relatives | Victor R Moss |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 1442 Arapahoe Ave, Salt Lake City, UT 84104 |
| Possible Relatives | Laurie Moss |
| Name / Names | Ray A Moss |
|---|---|
| Age | N/A |
| Person | 444 Sonnier Rd #111, Carencro, LA 70520 |
| Previous Address |
80952 PO Box, Lafayette, LA 70598 314 Malapart Rd #7, Lafayette, LA 70507 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | 120 KELSO RD, WATSON, AR 71674 |
| Phone Number | 870-644-9295 |
| Name / Names | Ray Moss |
|---|---|
| Age | N/A |
| Person | PO BOX 943, DALLAS, GA 30132 |
| Business Name | Yellow Cab |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | UT |
| Address | 1450 Washington Blvd Ogden UT 84404-5747 |
| Industry | Real Estate (Housing) |
| SIC Code | 6512 |
| SIC Description | Nonresidential Building Operators |
| Phone Number | 801-394-9411 |
| Business Name | Trans Usa Inc |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | MD |
| Address | 4300 Montgomery Ave Bethesda MD 20814-4412 |
| Industry | Business Services (Services) |
| SIC Code | 7389 |
| SIC Description | Business Services, Nec |
| Phone Number | 301-652-6662 |
| Business Name | Tennessee Baptist Child Homes |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | TN |
| Address | 9224 Quito Rd Millington TN 38053-4380 |
| Industry | Social Services (Services) |
| SIC Code | 8361 |
| SIC Description | Residential Care |
| Phone Number | 901-872-0839 |
| Business Name | Ray Moss Realtors |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | GA |
| Address | 3195 Buford Hwy Duluth GA 30096-5707 |
| Industry | Real Estate (Housing) |
| SIC Code | 6531 |
| SIC Description | Real Estate Agents And Managers |
| Phone Number | 770-476-1234 |
| [email protected] | |
| Number Of Employees | 3 |
| Annual Revenue | 389940 |
| Fax Number | 770-476-5141 |
| Business Name | Ray Moss Home Improvement |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | NY |
| Address | 403 Gates Ave East Meadow NY 11554-2306 |
| Industry | Building Construction - Operative Builders and General Contractors (Construction) |
| SIC Code | 1521 |
| SIC Description | Single-Family Housing Construction |
| Phone Number | 516-481-1683 |
| Business Name | R. M. Investments LLC |
|---|---|
| Person Name | Ray E Moss |
| Position | registered agent |
| State | GA |
| Address | 259 Apollo Rd, Lookout Mountain, GA 30750 |
| Business Contact Type | Organizer |
| Model Type | LLC |
| Locale | Domestic |
| Qualifier | None |
| Effective Date | 2014-03-04 |
| Entity Status | Active/Compliance |
| Type | Organizer |
| Business Name | Moss Bryan & Moss PC |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | IL |
| Address | 122 Warner Ct Clinton IL 61727-2066 |
| Industry | Legal Services (Services) |
| SIC Code | 8111 |
| SIC Description | Legal Services |
| Phone Number | 217-935-8341 |
| Number Of Employees | 9 |
| Annual Revenue | 1032060 |
| Business Name | Kirby Vacuum Co of Roswell |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | GA |
| Address | 1023 Mansell Rd Roswell GA 30076-1507 |
| Industry | Miscellaneous Retail (Stores) |
| SIC Code | 5963 |
| SIC Description | Direct Selling Establishments |
| Phone Number | 770-645-1270 |
| Business Name | Kirby Co |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | GA |
| Address | 1023 Mansell Rd Roswell GA 30076-1507 |
| Industry | Furnishing, Equipment and Home Furniture Stores (Stores) |
| SIC Code | 5722 |
| SIC Description | Household Appliance Stores |
| Phone Number | 770-645-1270 |
| Number Of Employees | 1 |
| Annual Revenue | 224540 |
| Fax Number | 770-645-1244 |
| Business Name | IVEY GATE CONDOMINIUM OWNER'S ASSOCIATION, IN |
|---|---|
| Person Name | Ray Moss |
| Position | registered agent |
| State | GA |
| Address | 349 Ivey Gate Ridge STE1, Dalton, GA 30720 |
| Business Contact Type | CFO |
| Model Type | Corp |
| Locale | Domestic |
| Qualifier | NonProfit |
| Effective Date | 2005-11-04 |
| Entity Status | Active/Compliance |
| Type | CFO |
| Business Name | Enterprise Rent-A-Car |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | NH |
| Address | 526 2nd St Manchester NH 03102-5238 |
| Industry | Gasoline Service Stations and Automotive Dealers (Automotive) |
| SIC Code | 5511 |
| SIC Description | New And Used Car Dealers |
| Phone Number | 603-623-7979 |
| Business Name | Desert Sleep Products |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | AZ |
| Address | 5511 N 51st Ave Ste 102 Glendale AZ 85301-6048 |
| Industry | Furniture and Fixtures (Products) |
| SIC Code | 2515 |
| SIC Description | Mattresses And Bedsprings |
| Phone Number | 623-931-2239 |
| Number Of Employees | 3 |
| Annual Revenue | 161600 |
| Business Name | Baptist Childrens Home |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | TN |
| Address | 9224 Quito Rd Millington TN 38053-4380 |
| Industry | Social Services (Services) |
| SIC Code | 8361 |
| SIC Description | Residential Care |
| Phone Number | 901-872-3178 |
| Business Name | Baptist Childrens Home |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | TN |
| Address | 6896 US Highway 70 Memphis TN 38133-3812 |
| Industry | Social Services (Services) |
| SIC Code | 8361 |
| SIC Description | Residential Care |
| Phone Number | 901-386-3961 |
| Business Name | Baptist Children's Home |
|---|---|
| Person Name | Ray Moss |
| Position | company contact |
| State | TN |
| Address | 6896 Us Highway 70 Memphis TN 38133-3895 |
| Industry | Social Services (Services) |
| SIC Code | 8322 |
| SIC Description | Individual And Family Services |
| Phone Number | 901-386-3961 |
| [email protected] | |
| Fax Number | 901-382-9754 |
| Website | www.tbch4kids.org |
| Person Name | Ray Moss |
|---|---|
| Filing Number | 800757698 |
| Position | Director |
| State | TX |
| Address | 1613 Elk Drive, Georgetown TX 78626 |
| State | AK |
|---|---|
| Calendar Year | 2018 |
| Employer | University Of Alaska Anchorage System |
| Job Title | Temporary Faculty Credit |
| Name | Moss Michael Ray |
| Annual Wage | $5,000 |
| State | AK |
|---|---|
| Calendar Year | 2017 |
| Employer | University Of Alaska Anchorage System |
| Name | Moss Michael Ray |
| Annual Wage | $8,397 |
| State | AL |
|---|---|
| Calendar Year | 2018 |
| Employer | University of Alabama |
| Name | Moss Darren Ray |
| Annual Wage | $89,048 |
| State | AL |
|---|---|
| Calendar Year | 2017 |
| Employer | University of Alabama |
| Name | Moss Darren Ray |
| Annual Wage | $78,812 |
| State | AL |
|---|---|
| Calendar Year | 2016 |
| Employer | University Of Alabama |
| Name | Moss Darren Ray |
| Annual Wage | $73,984 |
| Name | Ray J Moss |
|---|---|
| Address | 354 Sullivan Dr Colona IL 61241 -9644 |
| Phone Number | 309-255-3741 |
| Gender | Male |
| Date Of Birth | 1968-02-01 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $65,000 |
| Estimated Net Worth | $100,000 |
| Education | Completed College |
| Language | English |
| Name | Ray L Moss |
|---|---|
| Address | 2661 N Val Vista Dr Mesa AZ 85213 -1719 |
| Phone Number | 480-854-1800 |
| Gender | Male |
| Date Of Birth | 1931-01-01 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $65,000 |
| Estimated Net Worth | $0 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 135 Rainbow Dr Livingston TX 77399-1035 -1035 |
| Phone Number | 503-539-2838 |
| Gender | Unknown |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $10,000 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 3350 Clemans Rd Clarkston WA 99403 -9745 |
| Phone Number | 509-243-4036 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Ray A Moss |
|---|---|
| Address | 12726 Road 5.6 Ne Moses Lake WA 98837 APT 1-9401 |
| Phone Number | 509-765-1595 |
| Mobile Phone | 509-760-1232 |
| Gender | Male |
| Date Of Birth | 1946-09-24 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $65,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 3 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 1613 Elk Dr Georgetown TX 78626 -4612 |
| Phone Number | 512-240-4026 |
| [email protected] | |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $100,000 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Ray H Moss |
|---|---|
| Address | 1555 Bryden Rd Columbus OH 43205 APT 520-2181 |
| Phone Number | 614-253-3971 |
| [email protected] | |
| Gender | Male |
| Ethnicity | African American 1 |
| Ethnic Group | All African American Ethnic Groups |
| Estimated Household Income | $0 |
| Estimated Net Worth | $1 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 746 Emil Dr Arnold MO 63010 -2355 |
| Phone Number | 636-296-0142 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $25,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed High School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 1807 Marthas Bridge Rd Dalton GA 30720 -3871 |
| Phone Number | 706-226-3425 |
| [email protected] | |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $65,000 |
| Estimated Net Worth | $0 |
| Lines Of Credit Trade Counter | 2 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Ray A Moss |
|---|---|
| Address | 2087 Woodsong Way Fountain CO 80817 -1670 |
| Phone Number | 719-382-7352 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1949-12-19 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $60,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 775 Vildo Rd Bolivar TN 38008 -9685 |
| Phone Number | 731-377-9745 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $15,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 425 Otter Creek Ct Ne Atlanta GA 30328 -5708 |
| Phone Number | 770-394-5731 |
| Gender | Male |
| Date Of Birth | 1944-08-13 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $200,000 |
| Estimated Net Worth | $0 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 451 Cub Trl Cherry Log GA 30522-2218 -1367 |
| Phone Number | 770-833-1980 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $0 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Ray W Moss |
|---|---|
| Address | 1623 Hislop Dr Ogden UT 84404 -5317 |
| Phone Number | 801-621-4075 |
| Gender | Male |
| Date Of Birth | 1928-05-09 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $45,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 3 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 1045 Hollywood Ave Salt Lake City UT 84105 -3404 |
| Phone Number | 801-809-6264 |
| [email protected] | |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 3001 |
| Education | Completed High School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 2052 Valley Springs Ct Powhatan VA 23139 -5239 |
| Phone Number | 804-379-9165 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $200,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 10358 E Gibbs Ave Rosedale IN 47874 -9373 |
| Phone Number | 812-877-1618 |
| Gender | Male |
| Date Of Birth | 1953-05-26 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $150,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 101 |
| Education | Completed High School |
| Language | English |
| Name | Ray G Moss |
|---|---|
| Address | 610 W Baylor St Weatherford TX 76086 -4104 |
| Phone Number | 817-613-6787 |
| Gender | Male |
| Date Of Birth | 1947-08-05 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Ray Moss |
|---|---|
| Address | 515 W Gary St Broken Arrow OK 74012 -7860 |
| Phone Number | 918-606-5864 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $35,000 |
| Estimated Net Worth | $25,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Ray D Moss |
|---|---|
| Address | 4134 Ulman Ave North Port FL 34286 -6405 |
| Phone Number | 941-423-0222 |
| [email protected] | |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed Graduate School |
| Language | English |
| Name | MOSS, RAY III |
|---|---|
| Amount | 2500.00 |
| To | Weston Wamp (R) |
| Year | 2012 |
| Transaction Type | 15 |
| Filing ID | 12970161258 |
| Application Date | 2011-12-06 |
| Contributor Occupation | Owner |
| Contributor Employer | The Moss Company |
| Organization Name | Moss Co |
| Contributor Gender | M |
| Recipient Party | R |
| Recipient State | TN |
| Committee Name | Weston Wamp for Congress |
| Seat | federal:house |
| Address | 259 Apollo Rd LOOKOUT MOUNTAIN GA |
| Name | MOSS, RAY |
|---|---|
| Amount | 1000.00 |
| To | MUNTEAN, MICHAEL DAVID |
| Year | 2004 |
| Application Date | 2004-07-02 |
| Contributor Occupation | EXEC |
| Contributor Employer | HERITAGE CONSTRUCTION |
| Recipient Party | R |
| Recipient State | GA |
| Seat | state:lower |
| Address | 3195 BUFORD HWY STE 3 DULUTH GA |
| Name | MOSS, RAY |
|---|---|
| Amount | 250.00 |
| To | Tari Renner (D) |
| Year | 2004 |
| Transaction Type | 15 |
| Filing ID | 24962575030 |
| Application Date | 2004-10-12 |
| Contributor Occupation | attorney |
| Contributor Employer | Moss, Bryan & Moss, P.C. |
| Organization Name | Moss, Bryan & Moss |
| Contributor Gender | M |
| Recipient Party | D |
| Recipient State | IL |
| Committee Name | Renner for Congress |
| Seat | federal:house |
| Address | R R 2 Box 47 CLINTON IL |
| Name | MOSS, RAY |
|---|---|
| Amount | 250.00 |
| To | Alexander Giannoulias (D) |
| Year | 2010 |
| Transaction Type | 15 |
| Filing ID | 10020791989 |
| Application Date | 2010-09-08 |
| Contributor Occupation | ATTORNEY |
| Contributor Employer | MOSS & MOSS P.C. |
| Organization Name | Moss & Moss |
| Contributor Gender | M |
| Recipient Party | D |
| Recipient State | IL |
| Committee Name | Alexi for Illinois |
| Seat | federal:senate |
| Name | MOSS, RAY |
|---|---|
| Amount | 200.00 |
| To | Timothy Johnson (R) |
| Year | 2012 |
| Transaction Type | 15 |
| Filing ID | 12951421445 |
| Application Date | 2012-03-14 |
| Contributor Occupation | ATTORNEY |
| Contributor Employer | RAY MOSS AND ASSOCIATES/ATTORNEY |
| Organization Name | Ray Moss & Assoc |
| Contributor Gender | M |
| Recipient Party | R |
| Recipient State | IL |
| Committee Name | Friends of Tim Johnson |
| Seat | federal:house |
| Address | 9578 Violet Valley Rd CLINTON IL |
| Name | RAY H MOSS & TAMMIE J MOSS |
|---|---|
| Address | 11312 S Silver Lake Road Medical Lake WA |
| Value | 132000 |
| Landarea | 75,358 square feet |
| Bedrooms | 3 |
| Numberofbedrooms | 3 |
| Type | Residential |
| Price | 380000 |
| Basement | None |
| Name | RAY F MOSS |
|---|---|
| Address | Hastings Drive El Paso TX |
| Value | 255 |
| Landvalue | 255 |
| Type | Real |
| Name | RAY E MOSS |
|---|---|
| Address | 104 Mill Pond Road Roswell GA |
| Value | 10700 |
| Landvalue | 10700 |
| Buildingvalue | 54600 |
| Landarea | 1,380 square feet |
| Name | MOSS E RAY III |
|---|---|
| Address | 8205 Blue Lake Lane Harrison TN |
| Value | 21300 |
| Landvalue | 21300 |
| Landarea | 100 square feet |
| Type | Residential |
| Name | RAY MOSS |
|---|---|
| Type | Voter |
| State | KY |
| Address | 512 BARBERRY LN, NICHOLASVILLE, KY 40356 |
| Phone Number | 859-333-0357 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Type | Democrat Voter |
| State | UT |
| Address | 3418 FILLMORE AVE, OGDEN, UT 84403 |
| Phone Number | 801-510-9205 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Type | Independent Voter |
| State | UT |
| Address | 3418 FILLMORE AVE, OGDEN, UT 84403 |
| Phone Number | 801-510-9202 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Type | Democrat Voter |
| State | TN |
| Address | 2116 SUGAR CAMP RD, SPRINGFIELD, TN 37172 |
| Phone Number | 615-476-6773 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Type | Republican Voter |
| State | TN |
| Address | 629 OLIVE BRANCH RD, SMYRNA, TN 37167 |
| Phone Number | 615-473-3097 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Type | Voter |
| State | OH |
| Address | 1555 BRYDEN RD #520, COLUMBUS, OH 43205 |
| Phone Number | 614-507-4338 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Type | Voter |
| State | WA |
| Address | PO BOX 19184, SPOKANE, WA 99219 |
| Phone Number | 509-994-1724 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Type | Voter |
| State | WA |
| Address | 12726 ROAD 5.6 NE, MOSES LAKE, WA 98837 |
| Phone Number | 509-760-1232 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Type | Independent Voter |
| State | OK |
| Address | 1920 MAGNOLIA LN, EDMOND, OK 73013 |
| Phone Number | 405-706-8342 |
| Email Address | [email protected] |
| Name | RAY MOSS |
|---|---|
| Car | PONTIAC VIBE |
| Year | 2010 |
| Address | 131 MOHICAN CIR, SUMMERVILLE, SC 29483-9256 |
| Vin | 5Y2SP6E04AZ402469 |
| Phone | 843-871-6841 |
| Name | Ray Moss |
|---|---|
| Car | NISSAN VERSA |
| Year | 2008 |
| Address | 817 Kaylee Cir, Murfreesboro, TN 37128-8233 |
| Vin | 3N1BC13E38L377839 |
| Name | RAY MOSS |
|---|---|
| Car | CHEVROLET CORVETTE |
| Year | 2008 |
| Address | 12726 Road 5.6 NE, Moses Lake, WA 98837-9401 |
| Vin | 1G1YY36W085118792 |
| Name | RAY MOSS |
|---|---|
| Car | DODGE RAM PICKUP 2500 |
| Year | 2007 |
| Address | 12726 Road 5.6 NE, Moses Lake, WA 98837-9401 |
| Vin | 1D7KS28C47J505692 |
| Name | RAY MOSS |
|---|---|
| Car | CHEVROLET SILVERADO 1500 CLASSIC |
| Year | 2007 |
| Address | 242 CORBETT RD, NASHVILLE, NC 27856-8206 |
| Vin | 1GCEC14X87Z603018 |
| Name | RAY MOSS |
|---|---|
| Car | CHRYSLER PT CRUISER |
| Year | 2007 |
| Address | 1625 US HIGHWAY 117 N, BURGAW, NC 28425-3915 |
| Vin | 3A4FY58B77T583812 |
| Phone | 910-259-2647 |
| Name | Ray Moss |
|---|---|
| Domain | bretonvillagepediatricsandfamilymedicine.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2013-12-02 |
| Update Date | 2013-12-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | bretonvillagepediatrics.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2013-12-02 |
| Update Date | 2013-12-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | bretonvillagemd.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2013-12-02 |
| Update Date | 2013-12-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | bretonvillagemacfield.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2013-12-02 |
| Update Date | 2013-12-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | bretonvillagefamilymedicine.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2013-12-02 |
| Update Date | 2013-12-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | trustedhomeinspection.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2011-08-29 |
| Update Date | 2013-08-30 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | sweetseasonsshoes.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-03-21 |
| Update Date | 2013-03-22 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | threehoundslogistics.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2011-01-20 |
| Update Date | 2013-01-20 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | themettcompany.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2011-11-08 |
| Update Date | 2013-11-20 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17537 Ridge Ave. Spring Lake Michigan 49456 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | rntechnologymanagement.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-12-17 |
| Update Date | 2013-11-04 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 4541 Redman Ct SW Grandville Michigan 49418 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | raymossrealtors.com |
| Contact Email | [email protected] |
| Whois Sever | whois.wildwestdomains.com |
| Create Date | 2003-10-21 |
| Update Date | 2013-10-22 |
| Registrar Name | WILD WEST DOMAINS, LLC |
| Registrant Address | 3195 Buford Highway|Suite 3 Duluth Georgia 30096 |
| Registrant Country | UNITED STATES |
| Name | Ray Moss |
|---|---|
| Domain | raymoss.com |
| Contact Email | [email protected] |
| Whois Sever | whois.wildwestdomains.com |
| Create Date | 2003-10-21 |
| Update Date | 2013-10-22 |
| Registrar Name | WILD WEST DOMAINS, LLC |
| Registrant Address | 3195 Buford Highway|Suite 3 Duluth Georgia 30096 |
| Registrant Country | UNITED STATES |