We have found 227 public records related to Pete Martinez in 21 states . Ethnicity of all people found is Hispanic. Education levels of people we have found are: Completed High School and Completed College. All people found speak English language. There are 53 business registration records connected with Pete Martinez in public records. The businesses are registered in 8 different states. Most of the businesses are registered in Texas state. The businesses are engaged in 13 different industries. Most of the businesses are engaged in Automotive Services, Parking and Repair (Automotive) industry. There are 40 profiles of government employees in our database. People found have ten different job titles. Most of them are employed as Teacher. These employees work in 5 states: UT, CO, OR, NY and TX. Average wage of employees is $53,357.
| Name / Names | Pete N Martinez |
|---|---|
| Age | 52 |
| Birth Date | 1972 |
| Person | 1326 Roma Ln, Abilene, TX 79603 |
| Phone Number | 254-235-1572 |
| Possible Relatives |
Mary Isabel Martinez Raymond Martinez Marylisa L Martinez Raynmod Martinez Carl Reyes Martinez Fernando Martinez Victoria Gayton Martinez E Martinez Hugo Martinez |
| Previous Address |
6101 7th St #33, Abilene, TX 79605 388 Richland Dr #A, Waco, TX 76710 1410 32nd St, Abilene, TX 79602 5029 Inwood Dr, Waco, TX 76711 4901 Brookcrest, Waco, TX 76710 1207 9th St #C, Waco, TX 76707 5121 Tennyson Dr #C, Waco, TX 76710 4109 Brookcrest Cir, Waco, TX 76710 415 Owen Ln #101, Waco, TX 76710 1307 9th St #C, Waco, TX 76707 6801 Tennyson Dr #139, Waco, TX 76710 1307 N, Waco, TX 76707 518 12th St, Waco, TX 76701 |
| [email protected] |
| Name / Names | Pete Lupe Martinez |
|---|---|
| Age | 59 |
| Birth Date | 1965 |
| Also Known As | Pete L Martinez |
| Person | 272 Shelburn Dr #2, San Antonio, TX 78220 |
| Phone Number | 210-333-8671 |
| Possible Relatives |
Mary Alice Martinez Maryalice A Martinez Maria Lea Martinez Rene Melecio Martinez |
| Previous Address |
213 Avenue A, Yorktown, TX 78164 213 Avenue A, San Antonio, TX 78215 4302 Skelton Dr #2, San Antonio, TX 78219 |
| Name / Names | Pete T Martinez |
|---|---|
| Age | 64 |
| Birth Date | 1960 |
| Also Known As | Pedro Martinez |
| Person | 2122 19th St, Lubbock, TX 79401 |
| Phone Number | 806-748-7794 |
| Possible Relatives |
Elida M Martinez Karen Euresti Martinez Pete Martinez Alejandro Abrego Martinez Roman Martinez Maria M Martinez Maria Martinez Martinez Pedro Martinez Eliseo Martinez |
| Previous Address |
1414 Itasca St, Plainview, TX 79072 2724 Bates St, Lubbock, TX 79415 1006 Meadows Dr, Austin, TX 78758 4001 4th St, Lubbock, TX 79403 6104 Avenue Q #Q, Lubbock, TX 79412 2206 48th St, Lubbock, TX 79412 1803 66th St #A, Lubbock, TX 79412 |
| [email protected] | |
| Associated Business | Economy Paint & Body Economy Paint & Body Llc Economy Paint & Body, Llc |
| Name / Names | Pete Ronald Martinez |
|---|---|
| Age | 64 |
| Birth Date | 1960 |
| Also Known As | Pete Martinez |
| Person | 610 Finfrock St, Pasadena, TX 77506 |
| Phone Number | 713-477-5703 |
| Possible Relatives |
Martinez Irene Garza Ruben Martinez Raymond Martinez Mary Alvarez Martinez Christina Marie Martinez Alicia Jeanette Martinez Manuel V Martinez Irene A Martinez Maria Aurelia Martinez |
| Previous Address |
800 Finfrock St, Pasadena, TX 77506 714 Finfrock St, Pasadena, TX 77506 315 Richey St #27, Pasadena, TX 77506 |
| Name / Names | Pete Saldana Martinez |
|---|---|
| Age | 67 |
| Birth Date | 1957 |
| Also Known As | Pete Luico Martinez |
| Person | 6405 28th St, Lubbock, TX 79407 |
| Phone Number | 806-281-9019 |
| Possible Relatives |
Celia Saldana Martinez Jesse Lucio Martinez Lorenzo Cabrera Martinez Lorenzo Martinez Jeremias Saldana Martinez Dalia Martinez Jermey Martinez Erica Martinez Jeremy Martinez |
| Previous Address |
1311 37th St, Lubbock, TX 79412 253 PO Box, Lakin, KS 67860 3010 3rd St, Lubbock, TX 79415 210 Lincoln, Lakin, KS 67860 4206 16th St, Lubbock, TX 79416 |
| [email protected] |
| Name / Names | Pete Martinez |
|---|---|
| Age | 67 |
| Birth Date | 1957 |
| Also Known As | Pete A Martinez |
| Person | 198 Jim Miller Dr, Kyle, TX 78640 |
| Phone Number | 512-268-5798 |
| Possible Relatives |
Luis Jaime Martinez Martin Ontiveros Benitez Tammy Lynne Martinez Alma Oralia Martinez Jennifer Stafford Guerra Dora Maria Martinez Consuelo Martinez Alma Martinez Alma Vital Martinez |
| Previous Address |
212 Denise Ellen Dr, Buda, TX 78610 1201 Cullers Cv #C, Austin, TX 78745 10705 Maha Cir, Austin, TX 78747 8204 Citation Ave #A, Austin, TX 78719 1201 Broadmoor Dr, Austin, TX 78723 |
| Name / Names | Pete Guerra Martinez |
|---|---|
| Age | 68 |
| Birth Date | 1956 |
| Person | 232 Hiawatha St, Corpus Christi, TX 78405 |
| Phone Number | 361-334-6770 |
| Possible Relatives |
Rose Marie Martinez Timothy Gregory Martinez Nicholas Matthew Martinez Peter G Martinez Tim Martinez R Martinez Jim Martinez |
| Previous Address |
7845 Armstrong Dr #5406, Corpus Christi, TX 78413 232 Hiawatha St, Crp Christi, TX 78405 |
| Name / Names | Pete G Martinez |
|---|---|
| Age | 71 |
| Birth Date | 1953 |
| Person | 144 PO Box, El Campo, TX 77437 |
| Phone Number | 979-543-5291 |
| Possible Relatives |
Christine Martinez Vasquez Lorena Gusman Martinez Patricia Ann Martinez Cynthia Raquel Martinez |
| Previous Address |
211 Avenue I #144, El Campo, TX 77437 211 Ave I, El Campo, TX 77437 211 I, El Campo, TX 77437 211 I Ave, El Campo, TX 77437 |
| Name / Names | Pete Varges Martinez |
|---|---|
| Age | 71 |
| Birth Date | 1953 |
| Also Known As | Pete Artinez |
| Person | 149 PO Box, Glen Flora, TX 77443 |
| Phone Number | 979-255-5728 |
| Possible Relatives |
Pauline Anne Martinez Mary T Martinez Jr Pete Martinez |
| Previous Address |
75 PO Box, Glen Flora, TX 77443 139 Alley St, Glen Flora, TX 77443 139 Alley, Glen Flora, TX 77443 139 Aly, Glen Flora, TX 77443 139 Allen, Glen Flora, TX 77443 CITRUS PO Box, Glen Flora, TX 77443 75 PO Box, El Campo, TX 77437 |
| Name / Names | Pete A Martinez |
|---|---|
| Age | 71 |
| Birth Date | 1953 |
| Person | 1816 8th St, Tucumcari, NM 88401 |
| Phone Number | 505-461-3729 |
| Possible Relatives |
Mateo Martinez Loretta A Martinez Orlando Martinez Frank Martinez Martinez Brandi Sorge Belinda Rios Martinez Connie Martinez Susano Martinez Betsy Martinez |
| Previous Address |
1046 Lopez Rd, Albuquerque, NM 87105 10735 PO Box, Lubbock, TX 79408 524 40th St, Lubbock, TX 79404 426 PO Box, Lubbock, TX 79408 426 RR 4 #426, Lubbock, TX 79424 1525 PO Box, Tucumcari, NM 88401 |
| Name / Names | Pete Arthur Martinez |
|---|---|
| Age | 73 |
| Birth Date | 1951 |
| Person | 410 1st St, Rocky Ford, CO 81067 |
| Phone Number | 719-254-6583 |
| Possible Relatives |
Julia Leejane Martinez Lee Janej Martinez John C Martinez Fred M Martinez Jane Martinez Cheryl Lynn Martinez Sheryl Martinez James Martinez |
| Previous Address |
000410 1st St, Rocky Ford, CO 81067 255 PO Box, Rocky Ford, CO 81067 6 St T, Rocky Ford, CO 81067 |
| Name / Names | Pete R Martinez |
|---|---|
| Age | 75 |
| Birth Date | 1949 |
| Person | 5319 Ridge Turn Dr, Houston, TX 77053 |
| Phone Number | 281-437-9525 |
| Possible Relatives |
Pedro Robles Martinez Michael David Martinez Robert Lugo Martinez Michael D Martinez Marcelina Lugo Martinez Richard Martinez Michael D Martinez M Martinez |
| Previous Address | 5319RIDGET Dr, Houston, TX 77053 |
| Name / Names | Pete Martinez |
|---|---|
| Age | 82 |
| Birth Date | 1942 |
| Also Known As | Pete Martinez |
| Person | 800 Bouziden Dr, Moore, OK 73160 |
| Phone Number | 405-799-4738 |
| Possible Relatives |
Sharon E Martinez Brent Scott Martinez Jason Juan Martinez Stephanie Kenkaye Martinez Jr Pete Martinez Shiralyn N Martinez Deanna C Martinez |
| Previous Address |
800 Bouziden Dr, Oklahoma City, OK 73160 2409 Knox Dr, Oklahoma City, OK 73115 2541 PO Box, Edgewood, NM 87015 165512 PO Box, Irving, TX 75016 8 Olsen Ave, Edgewood, NM 87015 1524 61st St, Oklahoma City, OK 73159 2001 Country Club Rd #906, El Reno, OK 73036 |
| Name / Names | Pete David Martinez |
|---|---|
| Age | 83 |
| Birth Date | 1941 |
| Person | 3334 Truman Ave, El Paso, TX 79930 |
| Phone Number | 915-366-6306 |
| Possible Relatives |
Josefina Martinez Victor Manuel Martinez Luis Carlos Martinez Alfonso Sandoval Martinez Rose E Martinez |
| Previous Address |
5113 Mesa St #241, El Paso, TX 79912 5113 Mesa St #B241, El Paso, TX 79912 |
| Name / Names | Pete Rodriguez Martinez |
|---|---|
| Age | 84 |
| Birth Date | 1939 |
| Also Known As | Pete J Martinez |
| Person | 902 Avenue J #802, Freeport, TX 77541 |
| Phone Number | 979-233-1890 |
| Possible Relatives |
Julia Lee Martinez Carmen Marie Martinez Federico H Martinez Mark Lee Martinez Rene Martinez Yolanda Leija Martinez Alejandro O Martinez Gertrudiz Lopez Martinez Regina Lynn Martinez |
| Previous Address |
902 Avenue J #608, Freeport, TX 77541 902 Avenue J #908, Freeport, TX 77541 1506 8th St, Freeport, TX 77541 902 Avenue J, Freeport, TX 77541 506 8th St, Freeport, TX 77541 |
| Name / Names | Pete S Martinez |
|---|---|
| Age | 87 |
| Birth Date | 1936 |
| Also Known As | Pedro Martinez |
| Person | 5954 Williams Dr, Corpus Christi, TX 78412 |
| Phone Number | 361-985-8089 |
| Possible Relatives |
Rosa O Martinez June C Martinez Rosemary Martinez Rosa O Martinez Judith A Martinez Pedro Martinez Roxanne Martinez |
| Previous Address |
5954 Williams Dr #5, Corpus Christi, TX 78412 1363 PO Box, Robstown, TX 78380 1601 Airline Rd #35, Crp Christi, TX 78412 1335 6th Ave, Scottsbluff, NE 69361 1601 Airline Rd #35, Corpus Christi, TX 78412 5954 Williams Dr #O5, Crp Christi, TX 78412 240136 Lake Minatare Rd, Scottsbluff, NE 69361 318 PO Box, Scottsbluff, NE 69363 |
| Name / Names | Pete Alvarez Martinez |
|---|---|
| Age | 97 |
| Birth Date | 1926 |
| Person | 2109 12th St, Austin, TX 78703 |
| Phone Number | 512-477-2322 |
| Possible Relatives |
Cynthia Yvette Martinez Jean Paulette Martinez Donald Gregory Martinez Miguel Lopez Martinez Alvaro Lopez Martinez Esther Hernandez Martinez Christopher A Martinez Evangelina Martinez Margaret Martinez |
| Previous Address |
237 Bobs Trl, Bastrop, TX 78602 4501 Dudmar Dr, Austin, TX 78735 2108 8th St, Austin, TX 78702 |
| Name / Names | Pete Martinez |
|---|---|
| Age | 97 |
| Birth Date | 1926 |
| Also Known As | Pete Coram |
| Person | 6425 Whitman Ave, Fort Worth, TX 76133 |
| Phone Number | 817-370-7669 |
| Possible Relatives |
David Alan Martin Martinez Rose Lydia A Martinez Juanita V Martinez Josefina Rodriguez Yvonne Cristina Martinez Julie Ann Martinez James Lee Martin Michele Martin |
| Previous Address |
1617 7th St, Pueblo, CO 81001 3514 Harding St, Fort Worth, TX 76106 3443 #3443, Fort Belvoir, VA 22060 2812 Loraine St, Fort Worth, TX 76106 1241 Downwood Dr, Burleson, TX 76028 2707 24th St, Fort Worth, TX 76106 3514 Hardy, Fort Worth, TX 76106 5301 Springlake Pkwy, Fort Worth, TX 76117 |
| [email protected] | |
| Associated Business | P & B Vending |
| Name / Names | Pete L Martinez |
|---|---|
| Age | N/A |
| Person | 3601 Magic Dr #102, San Antonio, TX 78229 |
| Possible Relatives |
Lorenzo R Martinez Joaquina Alvarado Martinez Enrique Eudel Martinez Annette G Martinez Erica Yvette Martinez |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 516 7th St, Leadville, CO 80461 |
| Phone Number | 719-486-1748 |
| Possible Relatives |
Gisette M Koskovichmart Pedro Martinz Martinez Gisette M Martinez |
| Previous Address | 324 Edison St #17, Brush, CO 80723 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 40717 W CHAMBERS DR, MARICOPA, AZ 85238 |
| Phone Number | 520-494-2104 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 408 E TULANE DR, TEMPE, AZ 85283 |
| Phone Number | 480-820-4414 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 908 Ashford St #4A, Brooklyn, NY 11207 |
| Possible Relatives |
Pedro Martinez Anthony D Martinez |
| Previous Address |
830 Ashford St #2D, Brooklyn, NY 11207 753 Van Siclen, New York, NY 10035 753 Van Siclen Av, New York, NY 10035 |
| Name / Names | Pete G Martinez |
|---|---|
| Age | N/A |
| Person | 1663 Villere St, New Orleans, LA 70116 |
| Possible Relatives |
Sandra M Martinez Sandra Martine |
| Previous Address | 2338 Cleveland Ave, New Orleans, LA 70119 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 413 PO Box, Anadarko, OK 73005 |
| Previous Address |
RR 1, Anadarko, OK 73005 Box, Anadarko, OK 00000 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 921 18th St, Corpus Christi, TX 78405 |
| Possible Relatives |
Lorenzo Martinez Norma Jeanchildren Swaenepoel Joe Pete Martinez Antonio R Martinez Gloria Margarita Martinez Lydia Hernandez Martinez Daniel Martinez Elusemia Martinez |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 712 Utah Ave, Weslaco, TX 78596 |
| Possible Relatives |
Patricia Martinez Pedro J Martinez Miranda M Martinez Sonia Patricia Martinez |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 6573 S DOWNING AVE, TUCSON, AZ 85756 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 17372 E TRAILS END RD, MAYER, AZ 86333 |
| Name / Names | Pete B Martinez |
|---|---|
| Age | N/A |
| Person | 24420 N BOURBON ALY, PAULDEN, AZ 86334 |
| Name / Names | Pete C Martinez |
|---|---|
| Age | N/A |
| Person | 6027 N 17TH AVE, PHOENIX, AZ 85015 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | PO BOX 61262, PHOENIX, AZ 85082 |
| Name / Names | Pete L Martinez |
|---|---|
| Age | N/A |
| Person | PO BOX 3525, SCOTTSDALE, AZ 85271 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 1320 15th #9, Miami, FL 33139 |
| Name / Names | Pete J Martinez |
|---|---|
| Age | N/A |
| Person | 255 PO Box, Rocky Ford, CO 81067 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 316 Naylor Cir, Corpus Christi, TX 78408 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 14220 N 60TH ST, SCOTTSDALE, AZ 85254 |
| Phone Number | 602-996-8924 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 1845 32nd Ave #E, Denver, CO 80211 |
| Possible Relatives | Nicolas Nmi Martinez |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 16001 N FACTORY ST, SURPRISE, AZ 85374 |
| Phone Number | 623-583-0660 |
| Name / Names | Pete A Martinez |
|---|---|
| Age | N/A |
| Person | 279 W CORRIENTE CT, QUEEN CREEK, AZ 85243 |
| Phone Number | 480-641-8750 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 5718 E CAMINO DEL APADRINAR, TUCSON, AZ 85706 |
| Phone Number | 520-884-5547 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 7495 S BRACKENBURY DR, TUCSON, AZ 85746 |
| Phone Number | 520-578-8499 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 1149 S SINOVA, MESA, AZ 85206 |
| Phone Number | 480-641-8750 |
| Name / Names | Pete L Martinez |
|---|---|
| Age | N/A |
| Person | 8112 E JAVELINA AVE, MESA, AZ 85209 |
| Phone Number | 480-986-1181 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 6747 E ARBOR AVE, MESA, AZ 85206 |
| Phone Number | 480-634-4626 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 5924 S PINTO RD, TUCSON, AZ 85746 |
| Phone Number | 520-908-0981 |
| Name / Names | Pete T Martinez |
|---|---|
| Age | N/A |
| Person | 3315 W TRONA DR, ELOY, AZ 85231 |
| Phone Number | 520-466-7072 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 531 REDLAND DOWNS DR, WETUMPKA, AL 36093 |
| Phone Number | 334-478-4296 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 10551 E DRAGOON AVE, MESA, AZ 85208 |
| Phone Number | 480-984-9720 |
| Name / Names | Pete Martinez |
|---|---|
| Age | N/A |
| Person | 1038 N 48TH ST LOT 40, PHOENIX, AZ 85008 |
| Business Name | Water Movers |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | NV |
| Address | 3445 Bunkerhill Dr North Las Vegas NV 89032-7991 |
| Industry | Business Services (Services) |
| SIC Code | 7359 |
| SIC Description | Equipment Rental And Leasing, Nec |
| Phone Number | 702-932-8822 |
| Number Of Employees | 8 |
| Annual Revenue | 1119960 |
| Fax Number | 702-932-8821 |
| Business Name | Son Lit Hill Christian Fllwshp |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | NM |
| Address | 24 Camino Montoya Santa Fe NM 87507-4260 |
| Industry | Membership Organizations (Organizations) |
| SIC Code | 8661 |
| SIC Description | Religious Organizations |
| Phone Number | 505-471-1956 |
| Number Of Employees | 4 |
| Business Name | Smithbilt Industries Inc |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | FL |
| Address | 26301 S Dixie Hwy Homestead FL 33032-6620 |
| Industry | Wholesale Trade - Durable Goods (Products) |
| SIC Code | 5039 |
| SIC Description | Construction Materials, Nec |
| Phone Number | 305-258-4233 |
| Business Name | Seaside Motel |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | FL |
| Address | 3008 Bayshore Dr Fort Lauderdale FL 33304-4209 |
| Industry | Camps, Rooming Houses, Hotels and Other Lodging Places (Lodging) |
| SIC Code | 7011 |
| SIC Description | Hotels And Motels |
| Phone Number | 954-462-1352 |
| Number Of Employees | 3 |
| Annual Revenue | 218250 |
| Fax Number | 954-462-3494 |
| Business Name | Petes Detail Corner |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | P.O. BOX 144 El Campo TX 77437-0144 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7542 |
| SIC Description | Carwashes |
| Phone Number | 979-543-7097 |
| Business Name | Pete's Automotive Svc |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | FL |
| Address | 3001 N Armenia Ave Tampa FL 33607-1631 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7538 |
| SIC Description | General Automotive Repair Shops |
| Phone Number | 813-870-0537 |
| Number Of Employees | 3 |
| Annual Revenue | 355350 |
| Business Name | Pete Martinez Trucking |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | P.O. BOX 75 Glen Flora TX 77443-0075 |
| Industry | Motor Freight Transportation (Transportation) |
| SIC Code | 4212 |
| SIC Description | Local Trucking, Without Storage |
| Phone Number | 979-677-3599 |
| Business Name | Pete Martinez Roofing |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 518 S 54th St Killeen TX 76543-4532 |
| Industry | Building Construction - Operative Builders and General Contractors (Construction) |
| SIC Code | 1521 |
| SIC Description | Single-Family Housing Construction |
| Phone Number | 254-690-5811 |
| Number Of Employees | 1 |
| Annual Revenue | 240720 |
| Business Name | Pete Martinez Plumbing & Htg |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | NE |
| Address | 7260 S Wedgewood Dr Lincoln NE 68510-4265 |
| Industry | Construction - Special Trade Contractors (Construction) |
| SIC Code | 1711 |
| SIC Description | Plumbing, Heating, Air-Conditioning |
| Phone Number | 402-488-9478 |
| Business Name | Pete Martinez Paint & Dry Wall |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 5218 Prince Valiant San Antonio TX 78218-2824 |
| Industry | Construction - Special Trade Contractors (Construction) |
| SIC Code | 1742 |
| SIC Description | Plastering, Drywall, And Insulation |
| Phone Number | 210-599-2062 |
| Business Name | Pacific Sunwear |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | FL |
| Address | 1441 Tamiami Trl # 543 Port Charlotte FL 33948-1098 |
| Industry | Apparel and Accessory Stores (Stores) |
| SIC Code | 5699 |
| SIC Description | Miscellaneous Apparel And Accessory Stores |
| Phone Number | 941-255-9150 |
| Number Of Employees | 13 |
| Annual Revenue | 1400800 |
| Business Name | ONDAMEX Records |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 3515 harlingen st, Dallas, TX 75212 |
| SIC Code | 736103 |
| Phone Number | |
| [email protected] |
| Business Name | Merrie Carol Grain |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | HI |
| Address | P.O. Box 695, Honolulu, HI 96809 |
| SIC Code | 521127 |
| Phone Number | |
| [email protected] |
| Business Name | Martinez Garage |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 1411 Rio Rico Rd Mercedes TX 78570-4512 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7538 |
| SIC Description | General Automotive Repair Shops |
| Phone Number | 956-565-4187 |
| Business Name | Hawaii Internet Emporium Inc |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | HI |
| Address | 1270 Queen Emma St # 510 Honolulu HI 96813-2307 |
| Industry | Business Services (Services) |
| SIC Code | 7375 |
| SIC Description | Information Retrieval Services |
| Phone Number | 808-538-7080 |
| [email protected] |
| Business Name | GRACE EVANGELICAL LUTHERAN CHURCH OF ANAHEIM, |
|---|---|
| Person Name | PETE MARTINEZ |
| Position | registered agent |
| Corporation Status | Active |
| Agent | PETE MARTINEZ 867 REDONDO, ANAHEIM, CA 92801 |
| Care Of | 700 W SOUTH ST, ANAHEIM, CA 92805 |
| CEO | PETE MARTINEZ867 REDONDO, ANAHEIM, CA 92801 |
| Incorporation Date | 1909-01-12 |
| Corporation Classification | Religious |
| Business Name | GRACE EVANGELICAL LUTHERAN CHURCH OF ANAHEIM, |
|---|---|
| Person Name | PETE MARTINEZ |
| Position | CEO |
| Corporation Status | Active |
| Agent | 867 REDONDO, ANAHEIM, CA 92801 |
| Care Of | 700 W SOUTH ST, ANAHEIM, CA 92805 |
| CEO | PETE MARTINEZ 867 REDONDO, ANAHEIM, CA 92801 |
| Incorporation Date | 1909-01-12 |
| Corporation Classification | Religious |
| Business Name | FITNESS SUPPLIERS, INC. |
|---|---|
| Person Name | PETE MARTINEZ |
| Position | CEO |
| Corporation Status | Suspended |
| Agent | 24630 NARBONNE AVE, LOMITA, CA 90717 |
| Care Of | * P O BOX 2884, PALOS VERDES, CA 90274 |
| CEO | PETE MARTINEZ 24630 NARBONNE AVE, LOMITA, CA 90717 |
| Incorporation Date | 1986-06-02 |
| Business Name | FITNESS SUPPLIERS, INC. |
|---|---|
| Person Name | PETE MARTINEZ |
| Position | registered agent |
| Corporation Status | Suspended |
| Agent | PETE MARTINEZ 24630 NARBONNE AVE, LOMITA, CA 90717 |
| Care Of | * P O BOX 2884, PALOS VERDES, CA 90274 |
| CEO | PETE MARTINEZ24630 NARBONNE AVE, LOMITA, CA 90717 |
| Incorporation Date | 1986-06-02 |
| Business Name | Enigma Collection |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 3118 Touraine Dr Dallas TX 75211-1650 |
| Industry | Miscellaneous Retail (Stores) |
| SIC Code | 5932 |
| SIC Description | Used Merchandise Stores |
| Phone Number | 214-337-7850 |
| Business Name | Eddie Sherman |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | HI |
| Address | 1270 Queen Emma Street, Honolulu, HI 96813-2307 |
| SIC Code | 594601 |
| Phone Number | |
| [email protected] |
| Business Name | Economy Paint & Body |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 2122 19th St Lubbock TX 79401-4506 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7532 |
| SIC Description | Top And Body Repair And Paint Shops |
| Phone Number | 806-763-2212 |
| Business Name | Chevron |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 315 Plantation Dr Lake Jackson TX 77566-6142 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7549 |
| SIC Description | Automotive Services, Nec |
| Phone Number | 979-297-3372 |
| Business Name | Charter Funding |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | HI |
| Address | 98-211 Pali Momi Street - Suite 103 - Aiea, AIEA, 96701 HI |
| [email protected] |
| Business Name | Carpet Plus |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | CO |
| Address | 201 Pike Ave Alamosa CO 81101-2392 |
| Industry | Furnishing, Equipment and Home Furniture Stores (Stores) |
| SIC Code | 5713 |
| SIC Description | Floor Covering Stores |
| Phone Number | 719-589-8726 |
| Number Of Employees | 2 |
| Annual Revenue | 182400 |
| Business Name | Canning Line Warehouse |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | CO |
| Address | 708 Railroad Ave Rocky Ford CO 81067-1231 |
| Industry | Wholesale Trade - Non-Durable Goods (Products) |
| SIC Code | 5191 |
| SIC Description | Farm Supplies |
| Phone Number | 719-254-3910 |
| Business Name | Burger King |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | AZ |
| Address | 2708 E University Dr Mesa AZ 85213-8452 |
| Industry | Eating and Drinking Establishments (Food) |
| SIC Code | 5812 |
| SIC Description | Eating Places |
| Phone Number | 480-827-0731 |
| [email protected] |
| Business Name | Bestway |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | P.O. BOX 1764 Laredo TX 78044-1764 |
| Industry | Wholesale Trade - Durable Goods (Products) |
| SIC Code | 5093 |
| SIC Description | Scrap And Waste Materials |
| Phone Number | 956-727-1404 |
| Business Name | Best Way Rags & Wipers |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 1719 N Arkansas Ave Laredo TX 78043-2750 |
| Industry | Wholesale Trade - Durable Goods (Products) |
| SIC Code | 5093 |
| SIC Description | Scrap And Waste Materials |
| Phone Number | 956-727-1404 |
| Number Of Employees | 3 |
| Annual Revenue | 1264320 |
| Business Name | Albuquerque Tortilla Company Inc |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | NM |
| Address | 4300 Alexander Blvd NE, Albuquerque, NM 87107 |
| SIC Code | 811103 |
| Phone Number | |
| [email protected] |
| Business Name | Aire Tech Heating & AC |
|---|---|
| Person Name | Pete Martinez |
| Position | company contact |
| State | TX |
| Address | 623 Pinewood Ln San Antonio TX 78216-6913 |
| Industry | Construction - Special Trade Contractors (Construction) |
| SIC Code | 1711 |
| SIC Description | Plumbing, Heating, Air-Conditioning |
| Phone Number | 210-824-7659 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 35234601 |
| Position | Director |
| State | TX |
| Address | 25114 HOLYOKE LANE, SPRING TX 77373 |
| Person Name | Pete Martinez |
|---|---|
| Filing Number | 36230001 |
| Position | Director |
| State | TX |
| Address | 258 Cicero, San Antonio TX 78218 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 102897500 |
| Position | PRESIDENT |
| State | TX |
| Address | 4700 BURLESON RD ST. A., AUSTIN TX 78744 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 102897500 |
| Position | VICE PRESIDENT |
| State | TX |
| Address | 4700 BURLESON RD ST. A., AUSTIN TX 78744 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 102897500 |
| Position | SECRETARY |
| State | TX |
| Address | 4700 BURLESON RD ST. A., AUSTIN TX 78744 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 102897500 |
| Position | TREASURER |
| State | TX |
| Address | 4700 BURLESON RD ST. A., AUSTIN TX 78744 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 102897500 |
| Position | DIRECTOR |
| State | TX |
| Address | 4700 BURLESON RD ST. A., AUSTIN TX 78744 |
| Person Name | Pete Martinez |
|---|---|
| Filing Number | 111151201 |
| Position | Director |
| State | TX |
| Address | 1001 N Avenue D, Beeville TX 78102 |
| Person Name | Pete Martinez |
|---|---|
| Filing Number | 111151201 |
| Position | President |
| State | TX |
| Address | 1001 N Avenue D, Beeville TX 78102 |
| Person Name | Pete Martinez |
|---|---|
| Filing Number | 133256801 |
| Position | Director |
| State | TX |
| Address | 3204 Libby St, Tyler TX 75707 2040 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 800116695 |
| Position | TREASURER |
| State | TX |
| Address | 1009 REED, Hurst TX 76053 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 800116695 |
| Position | Director |
| State | TX |
| Address | 1009 REED, Hurst TX 76053 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 800162639 |
| Position | TRUSTEE |
| State | TX |
| Address | 4604 LAKE PARK DR, WICHITA FALLS TX 76302 |
| Person Name | Pete Martinez |
|---|---|
| Filing Number | 800168351 |
| Position | Director |
| State | TX |
| Address | 3626 Madison Ave, Baytown TX 77520 |
| Person Name | Pete Martinez |
|---|---|
| Filing Number | 800168351 |
| Position | Treasurer |
| State | TX |
| Address | 3626 Madison Ave, Baytown TX 77520 |
| Person Name | Pete Martinez |
|---|---|
| Filing Number | 800406444 |
| Position | Director |
| State | TX |
| Address | 7703 Kincheon Ct., Austin TX 78749 |
| Person Name | Pete A Martinez |
|---|---|
| Filing Number | 800561320 |
| Position | Director |
| State | TX |
| Address | 1105 Pine Portage Loop, Leander TX 78641 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 800591230 |
| Position | MANAGING MEMBER |
| State | TX |
| Address | 5724 77TH, LUBBOCK TX 79415 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 800591230 |
| Position | DIRECTOR |
| State | TX |
| Address | 5724 77TH, LUBBOCK TX 79415 |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 800625639 |
| Position | SECRETARY |
| State | TX |
| Address | 4313 LEHIGH, MIDLAND TX 79705 |
| Person Name | Pete M Martinez |
|---|---|
| Filing Number | 143738801 |
| Position | Director |
| State | TX |
| Address | 600 W CLEVELAND BLVD, Aransas Pass TX |
| Person Name | PETE MARTINEZ |
|---|---|
| Filing Number | 800846666 |
| Position | Manager |
| State | TX |
| Address | 2202 STRAIGHT CREEK DR, HOUSTON TX 77017 |
| State | UT |
|---|---|
| Calendar Year | 2018 |
| Employer | University Of Utah |
| Name | Martinez Pete A |
| Annual Wage | $57,500 |
| State | TX |
|---|---|
| Calendar Year | 2016 |
| Employer | New Braunfels Isd |
| Name | Martinez Pete |
| Annual Wage | $18,990 |
| State | TX |
|---|---|
| Calendar Year | 2016 |
| Employer | Midwestern University |
| Name | Martinez Pete |
| Annual Wage | $30,231 |
| State | TX |
|---|---|
| Calendar Year | 2016 |
| Employer | City Of Midland |
| Job Title | Lifeguard |
| Name | Martinez Adrian Jay Pete |
| Annual Wage | N/A |
| State | TX |
|---|---|
| Calendar Year | 2016 |
| Employer | City Of Fort Worth |
| Job Title | Fire Lieutenant |
| Name | Martinez Pete |
| Annual Wage | $108,045 |
| State | TX |
|---|---|
| Calendar Year | 2015 |
| Employer | Robinson Isd |
| Job Title | Auxiliary |
| Name | Martinez Pete |
| Annual Wage | $21,924 |
| State | TX |
|---|---|
| Calendar Year | 2015 |
| Employer | Pharr-san Juan-alamo Isd |
| Job Title | Teacher |
| Name | Martinez Pete |
| Annual Wage | $53,404 |
| State | TX |
|---|---|
| Calendar Year | 2015 |
| Employer | New Braunfels Isd |
| Job Title | Auxiliary |
| Name | Martinez Pete |
| Annual Wage | $16,825 |
| State | TX |
|---|---|
| Calendar Year | 2015 |
| Employer | Midwestern University |
| Name | Martinez Pete |
| Annual Wage | $30,101 |
| State | TX |
|---|---|
| Calendar Year | 2016 |
| Employer | Pharr-san Juan-alamo Isd |
| Job Title | Teacher |
| Name | Martinez Pete |
| Annual Wage | $54,800 |
| State | TX |
|---|---|
| Calendar Year | 2015 |
| Employer | Department Of Family And Protective Services |
| Name | Martinez Pete L |
| Annual Wage | $42,448 |
| State | TX |
|---|---|
| Calendar Year | 2015 |
| Employer | City Of Fort Worth |
| Job Title | Fire Lieutenant |
| Name | Martinez Pete |
| Annual Wage | $103,365 |
| State | TX |
|---|---|
| Calendar Year | 2015 |
| Employer | Austin Isd |
| Job Title | Auxiliary |
| Name | Martinez Pete |
| Annual Wage | $28,303 |
| State | OR |
|---|---|
| Calendar Year | 2016 |
| Employer | Department Of Human Services |
| Name | Martinez Pete |
| Annual Wage | $78,489 |
| State | OR |
|---|---|
| Calendar Year | 2015 |
| Employer | Department Of Human Services |
| Job Title | Social Service Specialist 1 |
| Name | Martinez Pete |
| Annual Wage | $64,256 |
| State | NY |
|---|---|
| Calendar Year | 2018 |
| Employer | Bedford Central Schools |
| Name | Martinez Pete A |
| Annual Wage | $156,705 |
| State | NY |
|---|---|
| Calendar Year | 2017 |
| Employer | Bedford Central Schools |
| Name | Martinez Pete A |
| Annual Wage | $130,285 |
| State | NY |
|---|---|
| Calendar Year | 2016 |
| Employer | Bedford Central Schools |
| Name | Martinez Pete A |
| Annual Wage | $140,518 |
| State | TX |
|---|---|
| Calendar Year | 2015 |
| Employer | Department Of Aging And Disability Services |
| Name | Martinez Pete |
| Annual Wage | $46,844 |
| State | NY |
|---|---|
| Calendar Year | 2015 |
| Employer | Bedford Central Schools |
| Name | Martinez Pete A |
| Annual Wage | $115,187 |
| State | TX |
|---|---|
| Calendar Year | 2016 |
| Employer | Robinson Isd |
| Name | Martinez Pete |
| Annual Wage | $26,087 |
| State | TX |
|---|---|
| Calendar Year | 2016 |
| Employer | Texas Department Of Transportation |
| Name | Martinez Pete L |
| Annual Wage | $35,679 |
| State | TX |
|---|---|
| Calendar Year | 2018 |
| Employer | Town Of Christine |
| Job Title | Maintenance-Public |
| Name | Martinez Pete R |
| Annual Wage | $11,934 |
| State | TX |
|---|---|
| Calendar Year | 2018 |
| Employer | Taylor Isd |
| Job Title | Transportation |
| Name | Martinez Pete O |
| Annual Wage | $7,428 |
| State | TX |
|---|---|
| Calendar Year | 2018 |
| Employer | Santa Rosa Isd |
| Job Title | Teacher |
| Name | Martinez Pete D |
| Annual Wage | $66,596 |
| State | TX |
|---|---|
| Calendar Year | 2018 |
| Employer | New Braunfels Isd |
| Job Title | Custodial |
| Name | Martinez Pete |
| Annual Wage | $21,672 |
| State | TX |
|---|---|
| Calendar Year | 2018 |
| Employer | Health And Human Services Commission |
| Name | Martinez Pete |
| Annual Wage | $62,922 |
| State | TX |
|---|---|
| Calendar Year | 2018 |
| Employer | Eagle Pass Isd |
| Job Title | Teacher |
| Name | Martinez Sabina Pete |
| Annual Wage | $62,047 |
| State | TX |
|---|---|
| Calendar Year | 2018 |
| Employer | Department Of Family And Protective Services |
| Name | Martinez Pete L |
| Annual Wage | $36,928 |
| State | TX |
|---|---|
| Calendar Year | 2016 |
| Employer | Texas Department Of Transportation |
| Name | Martinez Pete |
| Annual Wage | $55,369 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | Town Of Christine |
| Job Title | Maintenance-Public Works |
| Name | Martinez Pete R |
| Annual Wage | $11,934 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | Santa Rosa Isd |
| Job Title | Teacher |
| Name | Martinez Pete |
| Annual Wage | $67,496 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | New Braunfels Isd |
| Name | Martinez Pete |
| Annual Wage | $21,070 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | Midwestern University |
| Name | Martinez Pete |
| Annual Wage | $21,942 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | Health And Human Services Commission |
| Name | Martinez Pete |
| Annual Wage | $14,373 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | Department Of Family And Protective Services |
| Name | Martinez Pete L |
| Annual Wage | $35,679 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | Department Of Aging And Disability Services |
| Name | Martinez Pete |
| Annual Wage | $45,245 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | City Of Fort Worth |
| Job Title | Fire Lieutenant |
| Name | Martinez Pete |
| Annual Wage | $109,974 |
| State | TX |
|---|---|
| Calendar Year | 2017 |
| Employer | Taylor Isd |
| Name | Martinez Pete |
| Annual Wage | $7,209 |
| State | CO |
|---|---|
| Calendar Year | 2017 |
| Employer | Denver Public Schools |
| Job Title | Teacher Intervention - Senior Team Lead |
| Name | Martinez Pete S |
| Annual Wage | $61,082 |
| Name | Pete Martinez |
|---|---|
| Address | 1743 W Roeser Rd Phoenix AZ 85041 -3819 |
| Mobile Phone | 602-505-4156 |
| Gender | Male |
| Date Of Birth | 1953-01-01 |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $15,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 101 |
| Education | Completed College |
| Language | English |
| Name | Pete Martinez |
|---|---|
| Address | 4145 Grove St Denver CO 80211 -1617 |
| Phone Number | 303-458-9194 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1953-02-07 |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $60,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 5 |
| Range Of New Credit | 5001 |
| Education | Completed High School |
| Language | English |
| Name | Pete F Martinez |
|---|---|
| Address | 4033 Wilkens Ave Baltimore MD 21229 -5009 |
| Phone Number | 443-835-3792 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1959-10-28 |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 101 |
| Education | Completed College |
| Language | English |
| Name | Pete Martinez |
|---|---|
| Address | 443 W Flint St Chandler AZ 85225 -4529 |
| Phone Number | 480-217-0537 |
| Gender | Male |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Net Worth | $50,000 |
| Range Of New Credit | 101 |
| Education | Completed College |
| Language | English |
| Name | Pete Martinez |
|---|---|
| Address | 40717 W Chambers Dr Maricopa AZ 85138 -9622 |
| Phone Number | 520-494-2104 |
| Gender | Male |
| Date Of Birth | 1967-01-01 |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $60,000 |
| Estimated Net Worth | $25,000 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Pete Martinez |
|---|---|
| Address | 390 N Calle Del Chancero Green Valley AZ 85614 -3031 |
| Phone Number | 520-573-1107 |
| Gender | Male |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $30,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 6 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Pete Martinez |
|---|---|
| Address | 1675 Budd Ave Maple Plain MN 55359 -9497 |
| Phone Number | 612-644-1969 |
| Gender | Male |
| Date Of Birth | 1950-12-29 |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $100,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 6 |
| Range Of New Credit | 101 |
| Education | Completed High School |
| Language | English |
| Name | Pete M Martinez |
|---|---|
| Address | 701 Kingston St Aurora CO 80010 -4103 |
| Phone Number | 720-858-8839 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1969-09-05 |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $60,000 |
| Estimated Net Worth | $100,000 |
| Range Of New Credit | 101 |
| Education | Completed High School |
| Language | English |
| Name | Pete A Martinez |
|---|---|
| Address | 493 River Rd Gaylordsville CT 06755 -1417 |
| Phone Number | 860-350-3683 |
| Gender | Male |
| Date Of Birth | 1969-07-29 |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $65,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 101 |
| Education | Completed College |
| Language | English |
| Name | Pete Martinez |
|---|---|
| Address | 2205 E 3rd Ave Flagstaff AZ 86004 -4222 |
| Phone Number | 928-774-8468 |
| Gender | Male |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $20,000 |
| Estimated Net Worth | $50,000 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Pete Martinez |
|---|---|
| Address | 500 Chatfield Cir Grand Junction CO 81504 -6266 |
| Phone Number | 970-434-9061 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Hispanic |
| Ethnic Group | Hispanic |
| Estimated Household Income | $55,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 101 |
| Education | Completed College |
| Language | English |
| Name | MARTINEZ, PETE |
|---|---|
| Amount | 900.00 |
| To | REPUBLICAN LEGISLATIVE DELEGATION CAMPAIGN CM |
| Year | 2004 |
| Application Date | 2002-05-23 |
| Recipient Party | R |
| Recipient State | LA |
| Committee Name | REPUBLICAN LEGISLATIVE DELEGATION CAMPAIGN CM |
| Address | PO BOX 3576 BATON ROUGE LA |
| Name | MARTINEZ, PETE |
|---|---|
| Amount | 500.00 |
| To | Cedric L Richmond (D) |
| Year | 2008 |
| Transaction Type | 15 |
| Filing ID | 28932682784 |
| Application Date | 2008-08-14 |
| Contributor Occupation | Director, State Gov't Affairs |
| Contributor Employer | PhRMA |
| Organization Name | Pharmaceutical Rsrch & Mfrs of America |
| Contributor Gender | M |
| Recipient Party | D |
| Recipient State | LA |
| Committee Name | Richmond for Congress |
| Seat | federal:house |
| Address | 1469 Hood Ave BATON ROUGE LA |
| Name | MARTINEZ, PETE |
|---|---|
| Amount | 500.00 |
| To | Donald J Cazayoux (D) |
| Year | 2008 |
| Transaction Type | 15 |
| Filing ID | 28932682248 |
| Application Date | 2008-08-14 |
| Contributor Occupation | Director, State Gov't Affairs |
| Contributor Employer | PhRMA |
| Organization Name | Pharmaceutical Rsrch & Mfrs of America |
| Contributor Gender | M |
| Recipient Party | D |
| Recipient State | LA |
| Committee Name | Cazayoux for Congress |
| Seat | federal:house |
| Address | 1469 Hood Ave BATON ROUGE LA |
| Name | MARTINEZ, PETE H |
|---|---|
| Amount | 500.00 |
| To | Cedric L. Richmond (D) |
| Year | 2010 |
| Transaction Type | 15 |
| Filing ID | 29992957994 |
| Application Date | 2009-09-17 |
| Contributor Occupation | Director, State Gov't Affairs |
| Contributor Employer | PhRMA |
| Organization Name | Pharmaceutical Rsrch & Mfrs of America |
| Contributor Gender | M |
| Recipient Party | D |
| Recipient State | LA |
| Committee Name | Richmond for Congress |
| Seat | federal:house |
| Address | 1469 Hood Ave BATON ROUGE LA |
| Name | MARTINEZ, PETE |
|---|---|
| Amount | 50.00 |
| To | RICHARDSON, BILL (G) |
| Year | 2006 |
| Application Date | 2005-04-26 |
| Contributor Occupation | GOVERNMENT EMPLOYEE-LAND OFFICE |
| Recipient Party | D |
| Recipient State | NM |
| Seat | state:governor |
| Address | 1324 LUJAN ST SANTA FE NM |
| Name | MARTINEZ, PETE |
|---|---|
| Amount | 50.00 |
| To | PERSONHOODCOLORADO |
| Year | 2010 |
| Application Date | 2010-07-06 |
| Recipient Party | I |
| Recipient State | CO |
| Committee Name | PERSONHOODCOLORADO |
| Address | 4145 GROVE ST DENVER CO |
| Name | PETE MARTINEZ & JULIA MARTINEZ |
|---|---|
| Address | 3506 W Cedar Bayou Lynchburg Road Baytown TX 77521 |
| Value | 6600 |
| Landvalue | 6600 |
| Buildingvalue | 37344 |
| Name | MARTINEZ PETE J |
|---|---|
| Physical Address | 7711 HIDDEN CYPRESS DR, ORLANDO, FL 32822 |
| Owner Address | 7711 HIDDEN CYPRESS DR, ORLANDO, FLORIDA 32822 |
| Ass Value Homestead | 106280 |
| Just Value Homestead | 117278 |
| County | Orange |
| Year Built | 1999 |
| Area | 2092 |
| Land Code | Single Family |
| Address | 7711 HIDDEN CYPRESS DR, ORLANDO, FL 32822 |
| Name | MARTINEZ PETE, MARTINEZ JULIE |
|---|---|
| Physical Address | 9239 SPLIT STONE DR, WEBSTER, FL 33597 |
| Owner Address | 9239 SPLIT STONE DR, WEBSTER, FLORIDA 33597 |
| Ass Value Homestead | 56898 |
| Just Value Homestead | 56898 |
| County | Hernando |
| Year Built | 2002 |
| Area | 1565 |
| Applicant Status | Husband |
| Co Applicant Status | Wife |
| Land Code | Single Family |
| Address | 9239 SPLIT STONE DR, WEBSTER, FL 33597 |
| Name | MARTINEZ PETE, MARTINEZ JULIE |
|---|---|
| Physical Address | SPLIT STONE DR, WEBSTER, FL 33597 |
| Owner Address | 9239 SPLIT STONE DR, WEBSTER, FLORIDA 33597 |
| County | Hernando |
| Land Code | Vacant Residential |
| Address | SPLIT STONE DR, WEBSTER, FL 33597 |
| Name | PETE A MARTINEZ & DAWN M MARTINEZ |
|---|---|
| Address | 2423 Lavendale Court Austin TX 78748 |
| Value | 20000 |
| Landvalue | 20000 |
| Buildingvalue | 200325 |
| Type | Real |
| Name | PETE F MARTINEZ & GLORIA MARY MARTINEZ |
|---|---|
| Address | 4812 Jennings Circle The Colony TX |
| Value | 24840 |
| Landvalue | 24840 |
| Buildingvalue | 126127 |
| Landarea | 6,900 square feet |
| Bedrooms | 3 |
| Numberofbedrooms | 3 |
| Type | Real |
| Name | PETE G MARTINEZ JR & EMMA MARTINEZ |
|---|---|
| Address | 130 Wentwood Drive Murphy TX 75094-4417 |
| Value | 50000 |
| Landvalue | 50000 |
| Buildingvalue | 141210 |
| Name | PETE G MARTINEZ JR & SUSAN B MARTINEZ |
|---|---|
| Address | 168 High School Drive Lewisville TX |
| Value | 39126 |
| Landvalue | 39126 |
| Buildingvalue | 146026 |
| Landarea | 3,558 square feet |
| Bedrooms | 3 |
| Numberofbedrooms | 3 |
| Type | Real |
| Name | PETE JR/MARY A MARTINEZ |
|---|---|
| Address | 87-1950 R Pakeke Street Waianae HI |
| Value | 122700 |
| Landarea | 3,527 square feet |
| Name | PETE L MARTINEZ |
|---|---|
| Address | 2429 Lakeshore Drive Grand Prairie TX 75051 |
| Value | 46580 |
| Landvalue | 9340 |
| Buildingvalue | 46580 |
| Name | MARTINEZ PETE & LESLY |
|---|---|
| Physical Address | 1147 S COOPER DR, DELTONA, FL 32725 |
| Ass Value Homestead | 72666 |
| Just Value Homestead | 76148 |
| County | Volusia |
| Year Built | 1996 |
| Area | 1686 |
| Applicant Status | Husband |
| Co Applicant Status | Wife |
| Land Code | Single Family |
| Address | 1147 S COOPER DR, DELTONA, FL 32725 |
| Name | PETE L MARTINEZ & MARGARET A MARTINEZ |
|---|---|
| Address | 7260 S Wedgewood Drive Lincoln NE |
| Name | PETE M MARTINEZ & CECILIA MARTINEZ |
|---|---|
| Address | 2523 E 12th Street Pueblo CO 81001 |
| Name | PETE MARTINEZ |
|---|---|
| Address | 2238 Varsity Drive Grand Prairie TX 75051 |
| Value | 65750 |
| Landvalue | 21980 |
| Buildingvalue | 65750 |
| Name | PETE MARTINEZ |
|---|---|
| Address | 1617 E 7th Street Pueblo CO 81001 |
| Name | PETE MARTINEZ |
|---|---|
| Address | 408 Tulane Drive Tempe AZ 85283 |
| Value | 22000 |
| Landvalue | 22000 |
| Name | PETE MARTINEZ |
|---|---|
| Address | 204 Bandera Road Benbrook TX |
| Value | 15000 |
| Landvalue | 15000 |
| Buildingvalue | 27800 |
| Name | PETE MARTINEZ |
|---|---|
| Address | 4234 Annawood Circle Spring TX 77388 |
| Value | 18978 |
| Landvalue | 18978 |
| Buildingvalue | 105796 |
| Name | PETE MARTINEZ & DELA M MARTINEZ |
|---|---|
| Address | 1923 Valencia San Antonio TX |
| Name | PETE MARTINEZ & ELIZABETH MARTINEZ |
|---|---|
| Address | 1720 Pebblebrook Way Little Elm TX |
| Value | 30885 |
| Landvalue | 30885 |
| Buildingvalue | 106504 |
| Landarea | 7,267 square feet |
| Bedrooms | 3 |
| Numberofbedrooms | 3 |
| Type | Real |
| Name | PETE MARTINEZ & ELIZABETH MARTINEZ |
|---|---|
| Address | 4717 Knollview Lane Mesquite TX 75150 |
| Value | 87300 |
| Landvalue | 40000 |
| Buildingvalue | 87300 |
| Name | PETE M MARTINEZ |
|---|---|
| Address | 511 S Highland Avenue Midwest City OK |
| Value | 6600 |
| Landarea | 38,698 square feet |
| Type | Residential |
| Price | 50000 |
| Name | MARTINEZ PETE |
|---|---|
| Physical Address | 2049 CEDAR PARK LN, ORLANDO, FL 32824 |
| Owner Address | MARTINEZ LUZ, ORLANDO, FLORIDA 32824 |
| Ass Value Homestead | 163974 |
| Just Value Homestead | 167387 |
| County | Orange |
| Year Built | 2006 |
| Area | 3014 |
| Land Code | Single Family |
| Address | 2049 CEDAR PARK LN, ORLANDO, FL 32824 |
| Name | PETE MARTINEZ |
|---|---|
| Type | Republican Voter |
| State | AZ |
| Address | 1038 N 48TH ST, PHOENIX, AZ 85008 |
| Phone Number | 602-316-2063 |
| Email Address | [email protected] |
| Name | PETE MARTINEZ |
|---|---|
| Type | Voter |
| State | AZ |
| Address | 409 1/2 W CHOLLA ST, CASA GRANDE, AZ 85222 |
| Phone Number | 520-260-2732 |
| Email Address | [email protected] |
| Name | PETE MARTINEZ |
|---|---|
| Car | DODGE RAM PICKUP 1500 |
| Year | 2007 |
| Address | 807 S BIVINS ST, AMARILLO, TX 79104-1717 |
| Vin | 1D7HA18P77S114301 |
| Name | PETE MARTINEZ |
|---|---|
| Car | PONTIAC G5 |
| Year | 2007 |
| Address | 16039 W Acapulco Ln, Surprise, AZ 85379-5061 |
| Vin | 1G2AL15F977119802 |
| Name | PETE MARTINEZ |
|---|---|
| Car | GMC SIERRA 1500HD CLASSIC |
| Year | 2007 |
| Address | 1309 Johns Dr, Euless, TX 76039-2628 |
| Vin | 1GTGC13U47F159119 |
| Phone | 817-540-2302 |
| Name | Pete Martinez |
|---|---|
| Car | BMW 3 SERIES |
| Year | 2007 |
| Address | 3213 Greenwood Dr, Corpus Christi, TX 78405-2912 |
| Vin | WBAVB73597VH22824 |
| Phone | 361-883-2154 |
| Name | PETE MARTINEZ |
|---|---|
| Car | CHEVROLET TAHOE |
| Year | 2007 |
| Address | 511 E Republic St, Baytown, TX 77520-7251 |
| Vin | 1GNFC13097R279741 |
| Name | PETE A MARTINEZ |
|---|---|
| Car | CHEV COBA |
| Year | 2007 |
| Address | 246 COLORADO AVE, LORAIN, OH 44052-2089 |
| Vin | 1G1AK15F977326858 |
| Name | PETE MARTINEZ |
|---|---|
| Car | FORD RANGER |
| Year | 2007 |
| Address | 1001 Louise St, Houston, TX 77009-2955 |
| Vin | 1FTYR14U67PA38989 |
| Name | PETE MARTINEZ |
|---|---|
| Car | FORD TAURUS |
| Year | 2007 |
| Address | 3814 Rolinda Dr, Dallas, TX 75211-8521 |
| Vin | 1FAFP53U77A125508 |
| Name | PETE MARTINEZ |
|---|---|
| Car | Plymouth Voyager 3dr SE 113 WB |
| Year | 2007 |
| Address | 1704 Future Dr Apt B, Austin, TX 78754-4587 |
| Vin | 1UJBJ02R971EB0316 |
| Name | PETE MARTINEZ |
|---|---|
| Car | FORD EDGE |
| Year | 2007 |
| Address | PO BOX 227, LOZANO, TX 78568-0227 |
| Vin | 2FMDK39C87BA25923 |
| Name | PETE MARTINEZ |
|---|---|
| Car | FORD MUSTANG |
| Year | 2007 |
| Address | 1147 S COOPER DR, DELTONA, FL 32725-3644 |
| Vin | 1ZVFT80N875240595 |
| Name | PETE MARTINEZ |
|---|---|
| Car | TOYOTA TACOMA |
| Year | 2007 |
| Address | 130 WENTWOOD DR, MURPHY, TX 75094-4417 |
| Vin | 3TMJU62N87M033548 |
| Name | PETE MARTINEZ |
|---|---|
| Car | HONDA ELEMENT |
| Year | 2007 |
| Address | 168 HIGH SCHOOL DR, LEWISVILLE, TX 75057-4654 |
| Vin | 5J6YH187X7L011559 |
| Name | PETE MARTINEZ |
|---|---|
| Car | TOYOTA RAV4 |
| Year | 2007 |
| Address | 7540 NW 173RD LN, HIALEAH, FL 33015-7115 |
| Vin | JTMZK34V075011067 |
| Phone | 305-558-3503 |
| Name | PETE MARTINEZ |
|---|---|
| Car | BMW 5 SERIES |
| Year | 2007 |
| Address | 26006 MEADOWCREST DR, SAN ANTONIO, TX 78258-1905 |
| Vin | WBANE53567CY08306 |
| Name | pete martinez |
|---|---|
| Domain | assnink.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-05-02 |
| Update Date | 2013-05-03 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17418 sundrop houston Texas 77084 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | overlandparkmoneymanager.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | kansascityinvestmentmanager.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | kansascitymoneymanager.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | thekansascityfinancialplanner.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | overlandparkprivatewealthmanager.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | pete martinez |
|---|---|
| Domain | spacecitysounds.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-01-01 |
| Update Date | 2013-01-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17418 sundrop houston Texas 77084 |
| Registrant Country | UNITED STATES |
| Name | pete martinez |
|---|---|
| Domain | southremodeling.com |
| Contact Email | [email protected] |
| Whois Sever | whois.melbourneit.com |
| Create Date | 2008-11-07 |
| Update Date | 2013-11-11 |
| Registrar Name | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE |
| Registrant Address | 309 winecup tr Cedar Park TX 78613 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | shedsbyfiremen.com |
| Contact Email | [email protected] |
| Whois Sever | whois.wildwestdomains.com |
| Create Date | 2006-07-06 |
| Update Date | 2013-02-28 |
| Registrar Name | WILD WEST DOMAINS, LLC |
| Registrant Address | 7037 Wanda Way North Richland Hills Texas 76180 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | hargravemd.com |
| Contact Email | [email protected] |
| Whois Sever | whois.tucows.com |
| Create Date | 2010-01-27 |
| Update Date | 2012-12-29 |
| Registrar Name | TUCOWS DOMAINS INC. |
| Registrant Address | 221 W Colorado Blvd Pavillion II Ste 728 Dallas TX 75208 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 19725720423 |
| Name | Pete Martinez |
|---|---|
| Domain | overlandparkwealthmanager.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | overlandparkretirementplanner.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | kansascityprivatewealthmanager.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | overlandparkinvestmentmanager.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | ats2012.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2011-12-19 |
| Update Date | 2012-12-20 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | PO Box 2402 Roswell NM 88202 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | opusaim.com |
| Contact Email | [email protected] |
| Whois Sever | whois.melbourneit.com |
| Create Date | 2005-02-16 |
| Update Date | 2012-12-21 |
| Registrar Name | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE |
| Registrant Address | 18334 9 Mile Eastpointe MI 48021 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | rodeorecordsusa.com |
| Contact Email | [email protected] |
| Whois Sever | whois.register.com |
| Create Date | 2004-08-19 |
| Update Date | 2013-10-18 |
| Registrar Name | REGISTER.COM, INC. |
| Registrant Address | P.O. Box 1380 Denver CO 80201 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | gatekeeperrealestate.com |
| Contact Email | [email protected] |
| Whois Sever | whois.melbourneit.com |
| Create Date | 2005-07-21 |
| Update Date | 2012-11-28 |
| Registrar Name | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE |
| Registrant Address | 1105 Pine Portage Loop Leander TX 78641 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | overlandparkinvestmentadviser.com |
| Contact Email | [email protected] |
| Whois Sever | whois.fastdomain.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-01-24 |
| Registrar Name | FASTDOMAIN, INC. |
| Registrant Address | 7101 COLLEGE BOULEVARD, STE 1501 Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | pete martinez |
|---|---|
| Domain | halocontractingllc.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-05-03 |
| Update Date | 2013-05-04 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17418 sundrop houston Texas 77084 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | westernwaterresources.com |
| Contact Email | [email protected] |
| Whois Sever | whois.register.com |
| Create Date | 2006-08-25 |
| Update Date | 2013-10-17 |
| Registrar Name | REGISTER.COM, INC. |
| Registrant Address | P.O. Box 1380 Denver CO 80201 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | overlandparkfinancialadviser.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | petemartinez.com |
| Contact Email | [email protected] |
| Whois Sever | whois.melbourneit.com |
| Create Date | 2006-05-22 |
| Update Date | 2013-05-16 |
| Registrar Name | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE |
| Registrant Address | 18334 9 Mile Eastpointe MI 48021 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | hawaiipete.com |
| Contact Email | [email protected] |
| Whois Sever | whois.tucows.com |
| Create Date | 2011-01-14 |
| Update Date | 2013-01-12 |
| Registrar Name | TUCOWS DOMAINS INC. |
| Registrant Address | PO Box 1273 Kailua HI 96734 |
| Registrant Country | UNITED STATES |
| Name | Pete Martinez |
|---|---|
| Domain | kansascityretirementplanner.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-05-03 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7101 College Blvd. Overland Park Kansas 66210 |
| Registrant Country | UNITED STATES |
| Name | pete martinez |
|---|---|
| Domain | haloexcellencellc.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-05-03 |
| Update Date | 2013-05-04 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 17418 sundrop houston Texas 77084 |
| Registrant Country | UNITED STATES |
| Name | Martinez, Pete |
|---|---|
| Domain | underwaterleakdetective.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2008-05-14 |
| Update Date | 2009-05-06 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | ATTN insert domain name here care of Network Solutions PO Box 459 Drums PA 18222 |
| Registrant Country | UNITED STATES |