We have found 56 public records related to Lawren Smith in 12 states . Ethnicity of all people found is English. Education level of all people found is Completed College. All people found speak English language. We haven't found any business registration records connected with Lawren Smith. There are 11 profiles of government employees in our database. Job titles of people found are: Elementary, Teacher Assignment and Advisor Assignment. These employees work in 2 states: AR and OH. Average wage of employees is $24,889.
| Name / Names | Lawren Smith |
|---|---|
| Age | N/A |
| Person | 202 PARK AVE, BUENA VISTA, VA 24416 |
| Name / Names | Lawren Smith |
|---|---|
| Age | N/A |
| Person | 4010 VANDIVER CT, MONTGOMERY, AL 36110 |
| Name / Names | Lawren Smith |
|---|---|
| Age | N/A |
| Person | 340 BUFORD ST, MONTGOMERY, AL 36107 |
| Name / Names | Lawren A Smith |
|---|---|
| Age | N/A |
| Person | 3557 PRINCETON RD, MONTGOMERY, AL 36111 |
| Name / Names | Lawren E Smith |
|---|---|
| Age | N/A |
| Person | 111 TUCKER ST, LEXINGTON, VA 24450 |
| Phone Number | 540-463-5506 |
| Name / Names | Lawren C Smith |
|---|---|
| Age | N/A |
| Person | 6229 WALNUT GLEN DR, WILLOW SPRING, NC 27592 |
| Phone Number | 919-557-9076 |
| Name / Names | Lawren Smith |
|---|---|
| Age | N/A |
| Person | 3424 BRINKLEY RD, TEMPLE HILLS, MD 20748 |
| Phone Number | 240-493-6775 |
| Name / Names | Lawren A Smith |
|---|---|
| Age | N/A |
| Person | 3055 BARKSDALE ST, MONTGOMERY, AL 36110 |
| Phone Number | 334-269-2706 |
| Name / Names | Lawren Smith |
|---|---|
| Age | N/A |
| Person | 1150 Norton Ave, Marion, IN 46953 |
| Possible Relatives | Maxine Smith |
| Name / Names | Lawren Smith |
|---|---|
| Age | N/A |
| Person | 10580 Park Ter, Detroit, MI 48204 |
| Possible Relatives | David A Smith |
| Name / Names | Lawren R Smith |
|---|---|
| Age | N/A |
| Person | 11579 Dunloring Dr, Upper Marlboro, MD 20774 |
| Possible Relatives |
Kendra Smith Foster Sara C Smith John W Smith |
| State | OH |
|---|---|
| Calendar Year | 2017 |
| Employer | Worthington City |
| Job Title | Teacher Assignment |
| Name | Smith Lawren |
| Annual Wage | $40,920 |
| State | OH |
|---|---|
| Calendar Year | 2017 |
| Employer | Worthington City |
| Job Title | Advisor Assignment |
| Name | Smith Lawren |
| Annual Wage | $1,365 |
| State | OH |
|---|---|
| Calendar Year | 2016 |
| Employer | Worthington City |
| Job Title | Teacher Assignment |
| Name | Smith Lawren |
| Annual Wage | $38,261 |
| State | OH |
|---|---|
| Calendar Year | 2016 |
| Employer | Worthington City |
| Job Title | Advisor Assignment |
| Name | Smith Lawren |
| Annual Wage | $1,280 |
| State | OH |
|---|---|
| Calendar Year | 2015 |
| Employer | Worthington City |
| Job Title | Teacher Assignment |
| Name | Smith Lawren |
| Annual Wage | $35,896 |
| State | OH |
|---|---|
| Calendar Year | 2015 |
| Employer | Worthington City |
| Job Title | Advisor Assignment |
| Name | Smith Lawren |
| Annual Wage | $599 |
| State | OH |
|---|---|
| Calendar Year | 2014 |
| Employer | Worthington City |
| Job Title | Teacher Assignment |
| Name | Smith Lawren |
| Annual Wage | $56,130 |
| State | OH |
|---|---|
| Calendar Year | 2014 |
| Employer | Worthington City |
| Job Title | Advisor Assignment |
| Name | Smith Lawren |
| Annual Wage | $2,236 |
| State | OH |
|---|---|
| Calendar Year | 2013 |
| Employer | Worthington City |
| Job Title | Teacher Assignment |
| Name | Smith Lawren |
| Annual Wage | $55,574 |
| State | OH |
|---|---|
| Calendar Year | 2013 |
| Employer | Worthington City |
| Job Title | Advisor Assignment |
| Name | Smith Lawren |
| Annual Wage | $2,215 |
| State | AR |
|---|---|
| Calendar Year | 2018 |
| Employer | Vilonia School District |
| Job Title | Elementary |
| Name | Smith Lawren |
| Annual Wage | $39,299 |
| Name | Lawren A Smith |
|---|---|
| Address | 96 Donna Kay Dr Greenbrier AR 72058 -9579 |
| Phone Number | 501-679-4690 |
| Gender | Unknown |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $35,000 |
| Estimated Net Worth | $1 |
| Range Of New Credit | 3001 |
| Language | English |
| Name | Lawren O Smith |
|---|---|
| Address | 7716 Acuff Ln Shawnee KS 66216 -4203 |
| Phone Number | 913-631-4631 |
| [email protected] | |
| Gender | Unknown |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $250,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 3001 |
| Language | English |
| Name | Lawren A Smith |
|---|---|
| Address | 3203 Brookview Blvd Cleveland OH 44134-1356 -8319 |
| Phone Number | 919-331-0681 |
| Gender | Female |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $35,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 2 |
| Range Of New Credit | 3001 |
| Education | Completed College |
| Language | English |
| Name | SMITH JENNIFER M, SMITH LAWREN |
|---|---|
| Physical Address | 4459 BIRCHFIELD LOOP, SPRING HILL, FL 34609 |
| Owner Address | 4459 BIRCHFIELD LOOP, SPRING HILL, FLORIDA 34609 |
| Ass Value Homestead | 109934 |
| Just Value Homestead | 109934 |
| County | Hernando |
| Year Built | 2007 |
| Area | 3816 |
| Applicant Status | Wife |
| Co Applicant Status | Husband |
| Land Code | Single Family |
| Address | 4459 BIRCHFIELD LOOP, SPRING HILL, FL 34609 |
| Name | Lawren Smith |
|---|---|
| Domain | canon-hg20.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2011-04-19 |
| Update Date | 2013-04-19 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3100 Gold Dust Lane Willow Springs North Carolina 27592 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | defenseattorneyclevelandohio.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-05-26 |
| Update Date | 2013-05-27 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 762 Edgewood Rd Richmond Heights Ohio 44106 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | landscapingservicesinmayfieldheights.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-04-10 |
| Update Date | 2013-04-11 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 762 Edgewood Rd Richmond Heights Ohio 44106 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | guide2mlmsuccess.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-10-29 |
| Update Date | 2013-10-30 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | lawrenasmith.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-02-16 |
| Update Date | 2013-02-17 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | domainserviceforless.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-06-27 |
| Update Date | 2013-06-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | guidetomarketingsuccess.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-01-26 |
| Update Date | 2013-01-27 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | path2internetsuccess.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-07-17 |
| Update Date | 2013-06-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | domainservice4less.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-06-27 |
| Update Date | 2013-06-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | generatesuccessonline.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2008-12-27 |
| Update Date | 2012-12-28 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | datinginsidersecrets.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-10-21 |
| Update Date | 2013-10-22 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 202 Somersby Drive Dallas Georgia 30157 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | internetmlmsuccesssecrets.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-11-01 |
| Update Date | 2013-11-02 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | besuccessfulinmlm.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-08-22 |
| Update Date | 2013-06-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | tool4emailmarketing.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-06-27 |
| Update Date | 2013-06-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | mifi2372wifi.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-06-06 |
| Update Date | 2013-06-06 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 202 Somersby Drive Dallas Georgia 30157 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | prolapsedpiles.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2011-02-17 |
| Update Date | 2013-02-18 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3100 Gold Dust Lane Willow Springs North Carolina 27592 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | guide2marketingsuccess.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-01-26 |
| Update Date | 2013-01-27 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | generatemlmsuccessonline.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-10-29 |
| Update Date | 2013-10-30 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | lasppctracking.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2011-10-24 |
| Update Date | 2013-10-24 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3100 Gold Dust Lane Willow Springs North Carolina 27592 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | fatburning-furnaceinfo.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2011-02-21 |
| Update Date | 2013-02-22 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3100 Gold Dust Lane Willow Springs North Carolina 27592 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | netextractorreview.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-06-11 |
| Update Date | 2013-06-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 202 Somersby Drive Dallas Georgia 30157 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | generateprosperityonline.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-06-04 |
| Update Date | 2013-06-05 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | learnonlinemarketingstrategies.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-08-28 |
| Update Date | 2013-06-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 762 Edgewood Rd Richmond Heights Ohio 44106 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | articlemarketingonlineguide.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-12-14 |
| Update Date | 2012-12-15 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | leadsavalanche.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2013-09-24 |
| Update Date | 2013-09-24 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 135512 Olde Orchard Rd Strongsville Ohio 44136 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | workwithlawrensmith.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-02-23 |
| Update Date | 2013-03-23 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 202 Somersby Drive Dallas Georgia 30157 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | conquertheinternetmarketing.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-02-13 |
| Update Date | 2013-02-14 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 202 Somersby Drive Dallas Georgia 30157 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | articlemarketingsecrets2success.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-02-06 |
| Update Date | 2013-02-07 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 202 Somersby Drive Dallas Georgia 30157 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | turningbrowsersintobuyersonline.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-11-27 |
| Update Date | 2012-11-28 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 3576 Cloverdale Rd Montgomery Alabama 36111 |
| Registrant Country | UNITED STATES |
| Name | Lawren Smith |
|---|---|
| Domain | streamtvelocitya7tablet.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-09-03 |
| Update Date | 2013-06-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 202 Somersby Drive Dallas Georgia 30157 |
| Registrant Country | UNITED STATES |