We have found 99 public records related to Laurie Fish in 21 states . Ethnicity of all people found is Jewish. Education levels of people we have found are: Completed Graduate School, Completed College and Completed High School. All people found speak English language. There are 3 business registration records connected with Laurie Fish in public records. The businesses are registered in 2 states: NV and TX. There are no industries specified in public records for the businesses we have found. There are 6 profiles of government employees in our database. These employees work in 2 states: OR and NY. Average wage of employees is $61,912.
Name / Names | Laurie L Fish |
---|---|
Age | 48 |
Birth Date | 1976 |
Person | 513 County Route 77, Greenwich, NY 12834 |
Phone Number | 518-695-3121 |
Possible Relatives |
Eunice M Fish Walter H Fish Walter H Fish |
Previous Address |
13 Stark Rd #3, Corinth, NY 12822 Bald Mt, Greenwich, NY 12834 115E PO Box, Greenwich, NY 12834 4212 RR 1 POB, Greenwich, NY 12834 |
Name / Names | Laurie Kristin Fish |
---|---|
Age | 49 |
Birth Date | 1975 |
Also Known As | K Shepard |
Person | 88 Main St, Hull, MA 02045 |
Phone Number | 781-925-1804 |
Possible Relatives |
Sandra Allen Fish Katherine Reed Fischer Lauren J Fish |
Previous Address |
837 Wrightwood Ave #2, Chicago, IL 60614 53 High St, Boston, MA 02129 24 Mount Vernon St #102, Boston, MA 02108 48 River Rd, Hanover, NH 03755 8 Parkway, Hanover, NH 03755 Parkway, Hanover, NH 03755 45 Davenport St, Cambridge, MA 02140 431 Belden Ave, Chicago, IL 60614 431 Belden Ave #C304, Chicago, IL 60614 31 Buena Vista Park #1, Cambridge, MA 02140 2624 Burling St, Chicago, IL 60614 1220 Lasalle, Chicago, IL 60610 |
Name / Names | Laurie L Fish |
---|---|
Age | 49 |
Birth Date | 1975 |
Person | 115 PO Box, Greenwich, NY 12834 |
Phone Number | 518-695-6157 |
Name / Names | Laurie A Fish |
---|---|
Age | 51 |
Birth Date | 1973 |
Person | 286 Pioneer St, Gilbert, AZ 85233 |
Possible Relatives |
Robert M Fish Risa Fish |
Name / Names | Laurie A Fish |
---|---|
Age | 54 |
Birth Date | 1970 |
Person | 1710 Enfield Dr, Buffalo, IA 52728 |
Possible Relatives | Shaun R Fish |
Name / Names | Laurie A Fish |
---|---|
Age | 54 |
Birth Date | 1970 |
Person | 10020 74th St, Maquoketa, IA 52060 |
Possible Relatives |
Jackie V Mains Jackie Leroy Fish Betty Jean Fish Shane Leroy Fish Shaun R Fish |
Name / Names | Laurie A Fish |
---|---|
Age | 54 |
Birth Date | 1970 |
Person | 1324 3rd St, Princeton, IA 52768 |
Name / Names | Laurie J Fish |
---|---|
Age | 58 |
Birth Date | 1966 |
Also Known As | Laura Fish |
Person | 607 Portland Dr, Burnsville, MN 55337 |
Phone Number | 952-736-8488 |
Possible Relatives |
R Joseph Fish Russell J Fish |
Previous Address |
21 14th St, Cloquet, MN 55720 4141 Old Shakopee Rd #11, Minneapolis, MN 55437 1935 Old Shakopee Rd #25, Minneapolis, MN 55431 7605 Auto Club Rd, Minneapolis, MN 55438 14816 Co Rd #7, Burnsville, MN 55306 2041 Old Shakopee Rd #35, Minneapolis, MN 55431 935 Old Shakopee #25, Minneapolis, MN 55431 5908 136th Ln, Savage, MN 55378 15393 Jernigan St, Brooksville, FL 34613 4307 Orange, Holiday, FL 34691 |
Name / Names | Laurie L Fish |
---|---|
Age | 58 |
Birth Date | 1966 |
Also Known As | Laurie L Esty |
Person | 37 Boynton Rd, Buxton, ME 04093 |
Phone Number | 207-799-0669 |
Possible Relatives |
Christopher Andrewdaniel Esty Girl Esty Kevin R Fish K Esty Andy Esty |
Previous Address |
48 Curtis St, South Portland, ME 04106 2306 Hotel Rd, Auburn, ME 04210 45 Curtis St, South Portland, ME 04106 25 Cedar St, Westbrook, ME 04092 48 Curtis St, Portland, ME 04106 325 Austin St #4, Westbrook, ME 04092 |
[email protected] |
Name / Names | Laurie A Fish |
---|---|
Age | 59 |
Birth Date | 1965 |
Person | 2823 Falmouth Rd, Osterville, MA 02655 |
Phone Number | 508-420-4984 |
Possible Relatives |
Natalia Fish Julie Ann Fish |
Previous Address |
70 Winter St, Hyannis, MA 02601 433 Ocean St, Hyannis, MA 02601 |
Name / Names | Laurie Kingston Fish |
---|---|
Age | 60 |
Birth Date | 1964 |
Also Known As | L Fish |
Person | 67 Maplewood Dr, Middletown, NJ 07748 |
Phone Number | 410-770-5859 |
Possible Relatives |
Kennard Schuyler Keith Hollingsworth Fish Laurie Kingstonfish Fish Kenneth Kingstonfish Kenneth S Fish Christopher J Fish Ken S Fish Lawrence F Fish Daniel Fish |
Previous Address |
7432 Kevin Ave, Easton, MD 21601 67 Maplewood Dr, New Monmouth, NJ 07748 19 Tanglewood Rd, Middletown, NJ 07748 383 Laurelton Rd, Rochester, NY 14609 47 Chapel Hill Rd, Red Bank, NJ 07701 115 Evergreen Pl, East Orange, NJ 07018 |
Name / Names | Laurie A Fish |
---|---|
Age | 60 |
Birth Date | 1964 |
Also Known As | Laurie A Bell |
Person | 38 Orchard St, Glens Falls, NY 12801 |
Phone Number | 518-792-3640 |
Possible Relatives |
Ivan C Bell Charles E Fish Ivan C Bell Cin J Bell John Fish |
Previous Address |
181 PO Box, Glens Falls, NY 12801 Reardon, Queensbury, NY 12804 5 Reardon Rd, Queensbury, NY 12804 33 Sagamore St, Glens Falls, NY 12801 3 Manor Dr, Queensbury, NY 12804 |
Name / Names | Laurie J Fish |
---|---|
Age | 62 |
Birth Date | 1962 |
Person | 9541 Cornell Pl, Lakewood, CO 80227 |
Name / Names | Laurie E Fish |
---|---|
Age | 99 |
Birth Date | 1924 |
Person | 3545 Wilkinson Woods Dr, Sarasota, FL 34231 |
Phone Number | 941-921-2808 |
Possible Relatives |
John D Fish Jack David Fish James Douglas Fish |
Name / Names | Laurie Fish |
---|---|
Age | N/A |
Person | PO BOX 104, REEDERS, PA 18352 |
Phone Number | 570-688-1092 |
Name / Names | Laurie W Fish |
---|---|
Age | N/A |
Person | 74 A PEARL ST, HUDSON FALLS, NY 12839 |
Name / Names | Laurie Fish |
---|---|
Age | N/A |
Person | 1374 ROUTE 29, GALWAY, NY 12074 |
Name / Names | Laurie J Fish |
---|---|
Age | N/A |
Person | 21 14TH ST, CLOQUET, MN 55720 |
Name / Names | Laurie J Fish |
---|---|
Age | N/A |
Person | 294 HIGHWAY 33 N, CLOQUET, MN 55720 |
Name / Names | Laurie A Fish |
---|---|
Age | N/A |
Person | 10020 74TH ST, MAQUOKETA, IA 52060 |
Name / Names | Laurie A Fish |
---|---|
Age | N/A |
Person | 69 Station Rd, Glen Mills, PA 19342 |
Possible Relatives |
John Daniel Fish Beverly A Aunkst |
Name / Names | Laurie K Fish |
---|---|
Age | N/A |
Person | 67 MAPLEWOOD DR, MIDDLETOWN, NJ 7748 |
Phone Number | 732-706-3337 |
Name / Names | Laurie Michelle Fish |
---|---|
Age | N/A |
Person | 7351 Bromley Rd, West Jordan, UT 84084 |
Possible Relatives |
Rebecca Joyce Bezzant Brant Howard Fish Derek Atkinfish |
Previous Address | 3502 Farrington Ct, West Jordan, UT 84084 |
Associated Business | Mineral Hill |
Name / Names | Laurie O Fish |
---|---|
Age | N/A |
Person | 3231 59TH STREET TRL, VINTON, IA 52349 |
Phone Number | 319-453-7708 |
Name / Names | Laurie K Fish |
---|---|
Age | N/A |
Person | 88 MAIN ST, HULL, MA 2045 |
Phone Number | 781-925-1804 |
Name / Names | Laurie A Fish |
---|---|
Age | N/A |
Person | 5618 E HIAWATHA LN, STEVENSVILLE, MI 49127 |
Phone Number | 269-429-7778 |
Name / Names | Laurie L Fish |
---|---|
Age | N/A |
Person | 1544 LEAVITT WOODS LN, SHAKOPEE, MN 55379 |
Phone Number | 952-445-4691 |
Name / Names | Laurie F Fish |
---|---|
Age | N/A |
Person | 6700 S PACIFIC HWY W, MONMOUTH, OR 97361 |
Phone Number | 503-838-1739 |
Name / Names | Laurie Fish |
---|---|
Age | N/A |
Person | 750 Bridgton Rd, Westbrook, ME 04092 |
Name / Names | Laurie Fish |
---|---|
Age | N/A |
Person | 8948 Fairview Pl, Portland, OR 97223 |
Possible Relatives |
Davidduane Fish Jerry Fish |
Associated Business | Oregon Safe Step |
Name / Names | Laurie T Fish |
---|---|
Age | N/A |
Person | 286 N PIONEER ST, GILBERT, AZ 85233 |
Name / Names | Laurie E Fish |
---|---|
Age | N/A |
Person | 6136 PO Box, Nashua, NH 03063 |
Name / Names | Laurie Fish |
---|---|
Age | N/A |
Person | 156 PO Box, Tahlequah, OK 74465 |
Name / Names | Laurie M Fish |
---|---|
Age | N/A |
Person | 17381 Desert Lake Dr, Reno, NV 89508 |
Possible Relatives | Brant Howard Fish |
Name / Names | Laurie E Fish |
---|---|
Age | N/A |
Person | 3 Sapling Cir #2, Nashua, NH 03062 |
Name / Names | Laurie T Fish |
---|---|
Age | N/A |
Person | 14 Southshore Vw, Dallas, GA 30157 |
Possible Relatives |
Laurene A Talbott Roberta Marie Fish Robert M Fish |
Name / Names | Laurie Fish |
---|---|
Age | N/A |
Person | 525 Amherst St, Nashua, NH 03063 |
Possible Relatives | Ryan Fisher |
Name / Names | Laurie G Fish |
---|---|
Age | N/A |
Person | 2400 Harrah Rd #7, Harrah, OK 73045 |
Name / Names | Laurie A Fish |
---|---|
Age | N/A |
Person | 3024 42nd Ave, Greeley, CO 80634 |
Possible Relatives | Shaun Fish |
Name / Names | Laurie A Fish |
---|---|
Age | N/A |
Person | 1700 21ST AVE N, SAINT PETERSBURG, FL 33713 |
Phone Number | 727-894-0105 |
Name / Names | Laurie Fish |
---|---|
Age | N/A |
Person | 103 EMERALD DR, MINDEN, LA 71055 |
Phone Number | 318-299-3098 |
Name / Names | Laurie L Fish |
---|---|
Age | N/A |
Person | 513 COUNTY ROUTE 77, GREENWICH, NY 12834 |
Phone Number | 518-695-3121 |
Name / Names | Laurie W Fish |
---|---|
Age | N/A |
Person | 74 PEARL ST, HUDSON FALLS, NY 12839 |
Phone Number | 518-747-0955 |
Name / Names | Laurie A Fish |
---|---|
Age | N/A |
Person | 3024 42ND AVE, GREELEY, CO 80634 |
Name / Names | Laurie Fish |
---|---|
Age | N/A |
Person | 6600 SE DIVISION ST, APT 303 PORTLAND, OR 97206 |
Business Name | BROTHERS WHOLESALE AUTO, INC. |
---|---|
Person Name | LAURIE MICHELLE FISH |
Position | Secretary |
State | NV |
Address | PO BOX 27740 PO BOX 27740, LAS VEGAS, NV 89126 |
Inactive | F |
Terminated | F |
Resigned | F |
Corporation Type | Domestic Corporation |
Corporation Status | Permanently Revoked |
Corporation Number | C31042-2004 |
Creation Date | 2004-11-18 |
Type | Domestic Corporation |
Person Name | LAURIE A FISH |
---|---|
Filing Number | 801175054 |
Position | LTD PTR |
State | TX |
Address | 427 LIVE OAK LANE, BURLESON TX 76028 |
Person Name | LAURIE A FISH |
---|---|
Filing Number | 801175054 |
Position | GOVERNING PERSON |
State | TX |
Address | 427 LIVE OAK LANE, BURLESON TX 76028 |
State | OR |
---|---|
Calendar Year | 2017 |
Employer | School District of Central |
Name | Fish Laurie |
Annual Wage | $69,855 |
State | OR |
---|---|
Calendar Year | 2015 |
Employer | School District Of Central |
Name | Fish Laurie |
Annual Wage | $65,597 |
State | NY |
---|---|
Calendar Year | 2018 |
Employer | South Glens Falls Central Schools |
Name | Fish Laurie W |
Annual Wage | $61,704 |
State | NY |
---|---|
Calendar Year | 2017 |
Employer | South Glens Falls Central Schools |
Name | Fish Laurie W |
Annual Wage | $60,066 |
State | NY |
---|---|
Calendar Year | 2016 |
Employer | South Glens Falls Central Schools |
Name | Fish Laurie W |
Annual Wage | $58,346 |
State | NY |
---|---|
Calendar Year | 2015 |
Employer | South Glens Falls Central Schools |
Name | Fish Laurie W |
Annual Wage | $55,901 |
Name | Laurie Fish |
---|---|
Address | 717 D Ave Pollock SD 57648-2416 -2416 |
Mobile Phone | 605-437-2614 |
Gender | Female |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $25,000 |
Estimated Net Worth | $1 |
Range Of New Credit | 3001 |
Education | Completed College |
Language | English |
Name | Laurie A Fish |
---|---|
Address | 5618 E Hiawatha Ln Stevensville MI 49127 -9676 |
Phone Number | 269-429-7778 |
Gender | Female |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $175,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 3001 |
Education | Completed High School |
Language | English |
Name | Laurie D Fish |
---|---|
Address | 3231 59th Street Trl Vinton IA 52349 -9244 |
Phone Number | 319-453-7708 |
[email protected] | |
Gender | Female |
Date Of Birth | 1955-03-05 |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $55,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 3 |
Range Of New Credit | Greater than $9,999 |
Education | Completed College |
Language | English |
Name | Laurie F Fish |
---|---|
Address | 6700 S Pacific Hwy W Monmouth OR 97361 -9749 |
Phone Number | 503-838-1739 |
[email protected] | |
Gender | Female |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $50,000 |
Estimated Net Worth | $50,000 |
Range Of New Credit | 3001 |
Education | Completed High School |
Language | English |
Name | Laurie A Fish |
---|---|
Address | 130 W Dakota St Spearfish SD 57783-2615 -6103 |
Phone Number | 605-642-1082 |
Gender | Female |
Date Of Birth | 1968-01-01 |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $150,000 |
Estimated Net Worth | $1 |
Lines Of Credit Trade Counter | 3 |
Range Of New Credit | 3001 |
Education | Completed High School |
Language | English |
Name | Laurie A Fish |
---|---|
Address | Po Box 115 Pollock SD 57648 -0115 |
Phone Number | 605-889-2500 |
[email protected] | |
Gender | Female |
Date Of Birth | 1963-01-01 |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $50,000 |
Range Of New Credit | 3001 |
Education | Completed College |
Language | English |
Name | Laurie A Fish |
---|---|
Address | 69 Station Rd Glen Mills PA 19342 -1232 |
Phone Number | 610-459-8616 |
Telephone Number | 610-459-8616 |
Mobile Phone | 610-459-8616 |
[email protected] | |
Gender | Female |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $100,000 |
Estimated Net Worth | $250,000 |
Lines Of Credit Trade Counter | 3 |
Range Of New Credit | 5001 |
Education | Completed Graduate School |
Language | English |
Name | Laurie K Fish |
---|---|
Address | 67 Maplewood Dr Middletown NJ 07748 -1455 |
Phone Number | 732-706-3337 |
[email protected] | |
Gender | Female |
Date Of Birth | 1961-07-05 |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $75,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 3 |
Range Of New Credit | 3001 |
Education | Completed High School |
Language | English |
Name | Laurie A Fish |
---|---|
Address | 427 Live Oak Ln Burleson TX 76028 -6232 |
Phone Number | 817-447-4054 |
[email protected] | |
Gender | Female |
Date Of Birth | 1967-09-20 |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $75,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 3 |
Range Of New Credit | 501 |
Education | Completed Graduate School |
Language | English |
Name | Laurie L Fish |
---|---|
Address | 1544 Leavitt Woods Ln Shakopee MN 55379 -4325 |
Phone Number | 952-445-4691 |
Gender | Female |
Ethnicity | Jewish |
Ethnic Group | Jewish |
Estimated Household Income | $100,000 |
Estimated Net Worth | $250,000 |
Lines Of Credit Trade Counter | 3 |
Range Of New Credit | 3001 |
Education | Completed High School |
Language | English |
Name | LAURIE K FISH |
---|---|
Address | 88 Main Street Hull MA 02045 |
Value | 150000 |
Landvalue | 150000 |
Buildingvalue | 84600 |
Numberofbathrooms | 1 |
Bedrooms | 3 |
Numberofbedrooms | 3 |
Name | LAURIE FISH |
---|---|
Address | 427 Live Oak Lane Burleson TX |
Value | 25000 |
Landvalue | 25000 |
Name | LAURIE FISH |
---|---|
Address | 427 Live Oak Lane Burleson TX 76028-6232 |
Value | 710 |
Name | LAURIE FISH |
---|---|
Type | Independent Voter |
State | FL |
Address | 4029 BURLINGTON AVE NORTH, SAINT PETERSBURG, FL 33713 |
Phone Number | 727-327-6679 |
Email Address | [email protected] |
Name | LAURIE FISH |
---|---|
Type | Republican Voter |
State | SD |
Address | 717 D AVENUE, POLLOCK, SD 57648 |
Phone Number | 605-437-2614 |
Email Address | [email protected] |
Name | LAURIE J FISH |
---|---|
Visit Date | 4/13/10 8:30 |
Appointment Number | U27690 |
Type Of Access | VA |
Appt Made | 7/22/10 10:39 |
Appt Start | 7/31/10 11:00 |
Appt End | 7/31/10 23:59 |
Total People | 396 |
Last Entry Date | 7/22/10 10:39 |
Meeting Location | WH |
Caller | VISITORS |
Description | GROUP TOURS |
Release Date | 10/29/2010 07:00:00 AM +0000 |
Name | LAURIE FISH |
---|---|
Car | HYUNDAI VELOSTER |
Year | 2012 |
Address | 2651 Bancroft Dr, Aston, PA 19014-1701 |
Vin | KMHTC6AD0CU046994 |
Phone | 610-888-1982 |
Name | LAURIE FISH |
---|---|
Car | DODGE JOURNEY |
Year | 2012 |
Address | 1015 Johnson Ln, Spearfish, SD 57783-6103 |
Vin | 3C4PDDEG2CT235250 |
Phone | 605-642-1082 |
Name | LAURIE FISH |
---|---|
Car | DODGE GRAND CARAVAN |
Year | 2010 |
Address | 3502 W Farrington Ct, West Jordan, UT 84084-2714 |
Vin | 2D4RN5D10AR247330 |
Name | Laurie Fish |
---|---|
Car | TOYOTA HIGHLANDER |
Year | 2009 |
Address | 67 Maplewood Dr, Middletown, NJ 07748-1455 |
Vin | JTEDS41A892069185 |
Name | Laurie Fish |
---|---|
Domain | 5daytees.net |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-08-17 |
Update Date | 2012-12-27 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 69 station rd Glen mills Pennsylvania 19342 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | catfishwebworks.com |
Contact Email | [email protected] |
Whois Sever | whois.tucows.com |
Create Date | 2008-02-18 |
Update Date | 2012-12-27 |
Registrar Name | TUCOWS DOMAINS INC. |
Registrant Address | 69 Station Rd Glen Mills PA 19342 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | chugtees.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-08-13 |
Update Date | 2012-08-13 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 69 station rd Glen mills Pennsylvania 19342 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | calamitees.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-08-13 |
Update Date | 2012-08-13 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 69 station rd Glen mills Pennsylvania 19342 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | fivedaytees.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-08-17 |
Update Date | 2012-12-27 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 69 station rd Glen mills Pennsylvania 19342 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | femmepoloralphlauren.info |
Contact Email | [email protected] |
Create Date | 2013-02-05 |
Update Date | 2013-04-06 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | hommepoloralphlauren.info |
Contact Email | [email protected] |
Create Date | 2013-02-05 |
Update Date | 2013-04-06 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | paschersweatfranklinmarshall.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | polomensralphlaurenukoutlet.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | vesteralphlaurenfrance.info |
Contact Email | [email protected] |
Create Date | 2013-02-05 |
Update Date | 2013-04-06 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | franklinmarshalloutletsaleuk.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | taptherabbitt.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-08-13 |
Update Date | 2012-08-13 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 69 station rd Glen mills Pennsylvania 19342 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | pascherralphlaurenpolofr.info |
Contact Email | [email protected] |
Create Date | 2013-02-05 |
Update Date | 2013-04-06 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | franklinandmarshallsaleoutlets.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | sweatfranklinmarshallpascher.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | rugbyralphlaurenukoutletssale.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | pullralphlaurenfemme.info |
Contact Email | [email protected] |
Create Date | 2013-02-05 |
Update Date | 2013-04-06 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | ukpoloralphlaurenmens.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | uksalesralphlaurenoutletonline.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | polotshirtsukralphlauren.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | poloralphlaurenpascherfemme.info |
Contact Email | [email protected] |
Create Date | 2013-02-05 |
Update Date | 2013-04-06 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | outletsfranklinmarshallfemme.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | randomtee.net |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-08-12 |
Update Date | 2012-08-12 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 69 station rd Glen mills Pennsylvania 19342 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | femmevestefranklinmarshall.info |
Contact Email | [email protected] |
Create Date | 2013-02-04 |
Update Date | 2013-04-05 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 2742 Five Points Laurel MD 20707 |
Registrant Country | UNITED STATES |
Name | Laurie Fish |
---|---|
Domain | 5daytees.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-08-17 |
Update Date | 2012-12-27 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 69 station rd Glen mills Pennsylvania 19342 |
Registrant Country | UNITED STATES |