We have found 196 public records related to Joe Patton in 27 states . People found have 2 ethnicities: African American 1 and English. Education levels of people we have found are: Completed Graduate School, Completed High School and Completed College. All people found speak English language. There are 33 business registration records connected with Joe Patton in public records. The businesses are registered in 9 different states. Most of the businesses are registered in Texas state. The businesses are engaged in 9 different industries. Most of the businesses are engaged in Insurance Brokers, Agents and Services (Insurance) industry. There are 8 profiles of government employees in our database. Job titles of people found are: Sr Admin Specialist, Council Member, Pool Cashier and Program Director. These employees work in 4 states: KS, IN, OR and NM. Average wage of employees is $23,746.
| Name / Names | Joe F Patton |
|---|---|
| Age | 50 |
| Birth Date | 1974 |
| Person | 381 Old Hickory Rd, Hattieville, AR 72063 |
| Phone Number | 501-354-1685 |
| Possible Relatives |
Mary Lee Patton Lilburn Joe Patton Joseph F Patton Sandra J Schacherbauer Pamela Patton |
| Previous Address |
605 Glendale Ln, Rogers, AR 72758 3 PO Box, Little Rock, AR 72203 PO Box, Hattieville, AR 72063 1323 New Hope Rd, Rogers, AR 72758 27102 RR 3 POB, Little Rock, AR 72211 RR 1 POB 376F, Hattieville, AR 72063 53 PO Box, Lowell, AR 72745 |
| Name / Names | Joe Lee Patton |
|---|---|
| Age | 51 |
| Birth Date | 1973 |
| Person | 814 Conner Ave, Little Rock, AR 72202 |
| Phone Number | 870-535-6195 |
| Previous Address |
1604 Willow St, Pine Bluff, AR 71601 1015 Cypress St, Pine Bluff, AR 71601 |
| Name / Names | Joe Earl Patton |
|---|---|
| Age | 58 |
| Birth Date | 1966 |
| Person | 3010 Brook Manor Ave, Huntsville, AL 35816 |
| Phone Number | 256-539-2410 |
| Possible Relatives | Veronica T Patton |
| Previous Address |
319 Arnold Rd, New Market, AL 35761 2231 Jonathan Dr #B, Huntsville, AL 35810 562 PO Box, New Market, AL 35761 582 PO Box, New Market, AL 35761 |
| Name / Names | Joe Lewis Patton |
|---|---|
| Age | 58 |
| Birth Date | 1966 |
| Person | 4812 Cypress Creek Ave #A, Tuscaloosa, AL 35405 |
| Phone Number | 205-556-2363 |
| Possible Relatives |
Dorothy H Patton Clarence Patton |
| Previous Address |
2803 9th Ave, Tuscaloosa, AL 35401 3300 12 Av C Av, Tuscaloosa, AL 35405 3300 12th Ave #C, Tuscaloosa, AL 35405 |
| Name / Names | Joe Edward Patton |
|---|---|
| Age | 60 |
| Birth Date | 1964 |
| Also Known As | Joe Patton |
| Person | 2505 Finland St, Nashville, TN 37208 |
| Possible Relatives |
Kathy Estell Moore Stella M Patton Kelvin L Patton Wendell L Patton |
| Previous Address | 2717 Combs Dr, Nashville, TN 37207 |
| Name / Names | Joe D Patton |
|---|---|
| Age | 60 |
| Birth Date | 1964 |
| Also Known As | Don Patton |
| Person | 5827 Ky Highway 259 #N, Sweeden, KY 42285 |
| Phone Number | 270-286-4824 |
| Possible Relatives |
Sherry K Patton Vernon J Patton |
| Previous Address |
372 PO Box, Bee Spring, KY 42207 9022 Ky Highway 259, Bee Spring, KY 42207 107 PO Box, Bee Spring, KY 42207 |
| Name / Names | Joe L Patton |
|---|---|
| Age | 61 |
| Birth Date | 1963 |
| Also Known As | Joe L Patton |
| Person | 3500 Red Bank Rd, Cincinnati, OH 45227 |
| Phone Number | 901-680-0155 |
| Possible Relatives |
Susan Gail Riley John Love Patton Jimmie L Patton Natalie A Pedigo Ii Joel Patton |
| Previous Address |
4593 Oakview Ct, Liberty Twp, OH 45011 5510 Suggs Dr, Memphis, TN 38120 7348 Bellville Dr, Germantown, TN 38138 4593 Oakview Ct, Hamilton, OH 45011 710 Walnut Valley Ln, Cordova, TN 38018 5731 Sycamore Grove Ln, Memphis, TN 38120 3646 Philwood Ave, Memphis, TN 38122 188 Sunnyside Dr, Jackson, TN 38301 1861 Central Ave, Memphis, TN 38104 6556 Fountain Ave #3, Los Angeles, CA 90028 940 The Strand #3, Hermosa Beach, CA 90254 |
| Associated Business | Patton Family, Llc |
| Name / Names | Joe S Patton |
|---|---|
| Age | 61 |
| Birth Date | 1963 |
| Person | 600 Tomlinson Rd, Lebanon, TN 37087 |
| Phone Number | 615-449-5537 |
| Possible Relatives |
Gina K Patton Amanda C Patton |
| Previous Address |
176 RR 9, Lebanon, TN 37087 1786 Cedar Grove Rd, Lebanon, TN 37087 176 PO Box, Lebanon, TN 37088 |
| Name / Names | Joe Dan Patton |
|---|---|
| Age | 69 |
| Birth Date | 1955 |
| Also Known As | Dan Patton |
| Person | 4407 Black Walnut Woods St, San Antonio, TX 78249 |
| Phone Number | 210-492-6042 |
| Possible Relatives |
Susan Cardoza Patton Joe Patton Tyler Patton |
| Previous Address |
14206 Brenton Woods St, San Antonio, TX 78249 4224 Apple Tree Woods, San Antonio, TX 78249 5126 McFarland Blvd #F, Tuscaloosa, AL 35405 |
| Name / Names | Joe W Patton |
|---|---|
| Age | 69 |
| Birth Date | 1955 |
| Person | 512 Esters Blvd #2, Biloxi, MS 39530 |
| Possible Relatives |
Mary Parish Patton Linda Faye Gaddis Korchina Latasha Patton Slyvia Patton Joseph Patton Laura S Patton |
| Previous Address |
39261 Liberty St #3, Fremont, CA 94538 209 Grover Cleveland Cir, Jackson, MS 39213 2917 Madison St, Gulfport, MS 39501 338 Reynoir St, Biloxi, MS 39530 512 Ethel, Biloxi, MS 39530 512 Ethel Ct, Biloxi, MS 39530 1107 62nd Ave, Oakland, CA 94621 15055 Madison St, Gulfport, MS 39501 4001 Arbutus Ct, Hayward, CA 94542 1153 85th Ave, Oakland, CA 94621 |
| Name / Names | Joe Lavon Patton |
|---|---|
| Age | 71 |
| Birth Date | 1953 |
| Person | 1249 Lansing Dr, Spring Hill, FL 34608 |
| Phone Number | 352-684-0812 |
| Possible Relatives |
Suzanne F Patton George Lawrence Patton Daniel Horace Patton Teresa Johnson Patton Sorris S Patton Richard L Patton Brandon J Patton Dorris S Patton Hoai Huongtho Ton |
| Previous Address |
7028 Elsie St, Shreveport, LA 71108 213 Navajo Dr, Searcy, AR 72143 8002 PO Box, Searcy, AR 72145 01249 Lansing Dr, Spring Hill, FL 34608 712 Fernwood Dr, Benton, AR 72015 527 Estrella Ave, Loveland, CO 80537 909 Sevier St, Benton, AR 72015 1987 Hyde Dr, Loveland, CO 80538 |
| Name / Names | Joe Lee Patton |
|---|---|
| Age | 73 |
| Birth Date | 1951 |
| Also Known As | Joe W Patton |
| Person | 706 Jefferies Ave, Killeen, TX 76543 |
| Phone Number | 254-690-2394 |
| Possible Relatives |
Frankie L Patton Vincent B Patton |
| Name / Names | Joe E Patton |
|---|---|
| Age | 75 |
| Birth Date | 1949 |
| Person | 407 Maplewood Dr, Houma, LA 70364 |
| Phone Number | 985-868-6450 |
| Possible Relatives |
Lewis C Patton Francis R Patton Norma Aleen Patton Angela Dawn Girner Larry Ray Patton Thedrick D Patton Terry L Patton Maudie Patton Brenda J Patton |
| Previous Address |
49 Chadmore Dr, Fieldale, VA 24089 746 Ripley Rd, Baldwyn, MS 38824 1004 Morrow Rd #B, Courtland, MS 38620 155 Deer Run Rd, Danville, VA 24540 13 8th St, Fieldale, VA 24089 |
| Name / Names | Joe Lee Patton |
|---|---|
| Age | 75 |
| Birth Date | 1949 |
| Person | 5032 Lovell Ave, Fort Worth, TX 76107 |
| Phone Number | 817-732-1122 |
| Possible Relatives |
Mae B Patton Judy G Patton Tammy Lynn Patton L O Patton Misty Patton |
| Previous Address |
4136 Doyle St, Haltom City, TX 76117 4136 Doyle St, Fort Worth, TX 76117 |
| [email protected] |
| Name / Names | Joe E Patton |
|---|---|
| Age | 75 |
| Birth Date | 1949 |
| Also Known As | Joe Patton |
| Person | 3003 Quebec Dr, Baton Rouge, LA 70819 |
| Name / Names | Joe E Patton |
|---|---|
| Age | 75 |
| Birth Date | 1949 |
| Person | 12363 Shay Ave, Baton Rouge, LA 70815 |
| Name / Names | Joe E Patton |
|---|---|
| Age | 76 |
| Birth Date | 1948 |
| Person | 700 Gilman St #203, Ruston, LA 71270 |
| Phone Number | 318-932-7034 |
| Possible Relatives | Roshundra R Pattondixon |
| Previous Address |
1212 Sadie St, Coushatta, LA 71019 99 PO Box, Coushatta, LA 71019 Jackson Sq, Coushatta, LA 71019 |
| Name / Names | Joe Ray Patton |
|---|---|
| Age | 82 |
| Birth Date | 1942 |
| Person | 509 PO Box, Uvalde, TX 78802 |
| Phone Number | 830-278-5037 |
| Possible Relatives | Nathalie Campbell Patton |
| Previous Address |
409 Minter St, Uvalde, TX 78801 125 Bluebonnet Dr, Uvalde, TX 78801 409 Martin St, Uvalde, TX 78801 C Briar, Uvalde, TX 78802 DWR PO Box, Uvalde, TX 78802 Dr Po, Uvalde, TX 78802 |
| Associated Business | Blue Bird Freight Line Inc Patton Transportation Inc Blue Bird Freight Line, Inc |
| Name / Names | Joe Tom Patton |
|---|---|
| Age | 83 |
| Birth Date | 1941 |
| Person | 1236 Liberty Pike, Bell Buckle, TN 37020 |
| Phone Number | 931-216-8727 |
| Possible Relatives |
Patsy Sue Patton Frank Miller Patton |
| Previous Address |
39 RR 1, Bell Buckle, TN 37020 RR 1 D CLG HOME, Bell Buckle, TN 37020 39 PO Box, Bell Buckle, TN 37020 |
| Name / Names | Joe D Patton |
|---|---|
| Age | 87 |
| Birth Date | 1936 |
| Person | 6030 Bresslyn Rd, Nashville, TN 37205 |
| Phone Number | 615-352-1723 |
| Possible Relatives | Audrey R Patton |
| Name / Names | Joe H Patton |
|---|---|
| Age | 87 |
| Birth Date | 1936 |
| Also Known As | Joe Patton |
| Person | 641 84th St, Indianapolis, IN 46240 |
| Phone Number | 317-257-1228 |
| Possible Relatives |
Helen Patton John A Patton Gail C Patton Pat Patton Robert N Patton Richard C Patton Suzanne Patton |
| Previous Address |
8501 Broadway St, Camby, IN 5813 Prince William St, Louisville, KY 40207 1069 Berwick Ave, Indianapolis, IN 46222 |
| [email protected] |
| Name / Names | Joe Bailey Patton |
|---|---|
| Age | 91 |
| Birth Date | 1932 |
| Also Known As | Joe B Joe |
| Person | 735 Glen Abbey Dr, Mansfield, TX 76063 |
| Phone Number | 817-477-4807 |
| Possible Relatives |
Elaine Fishback Patton Shelah W Patton Martha Patton |
| Previous Address |
2308 Cypress Pt, Austin, TX 78746 4925 Staples Ave, Fort Worth, TX 76133 |
| [email protected] |
| Name / Names | Joe M Patton |
|---|---|
| Age | 91 |
| Birth Date | 1932 |
| Also Known As | Jm Patton |
| Person | 514 Jeffrey Ln, Collierville, TN 38017 |
| Phone Number | 901-853-9482 |
| Possible Relatives |
Maurita Ann Roland Timothy R Patton Norma Patton Patrick L Patton Clara L Patton Mike K Patton |
| Name / Names | Joe J Patton |
|---|---|
| Age | 95 |
| Birth Date | 1928 |
| Also Known As | J Patton |
| Person | 206 5th St, Warrior, AL 35180 |
| Phone Number | 205-647-2644 |
| Possible Relatives | Ethel James Patton |
| Previous Address |
2125 35th Ave, Birmingham, AL 35207 112 5th St, Warrior, AL 35180 700 10th Ave, Birmingham, AL 35204 912 6th Ave, Birmingham, AL 35204 912 6th St, Birmingham, AL 35204 2325 29th Ave, Birmingham, AL 35207 |
| Name / Names | Joe Glenn Patton |
|---|---|
| Age | 102 |
| Birth Date | 1921 |
| Also Known As | Joe G Patton |
| Person | 304 PO Box, Pearsall, TX 78061 |
| Phone Number | 830-334-3035 |
| Possible Relatives | Mildred Riddle Patton |
| Previous Address |
565 PO Box, Pearsall, TX 78061 109 Larkspur Dr, Uvalde, TX 78801 304 Margo Dr, Pearsall, TX 78061 BenitezCh Sta, Pearsall, TX 78061 666 PO Box, Pearsall, TX 78061 |
| Name / Names | Joe A Patton |
|---|---|
| Age | N/A |
| Also Known As | Joe A Patton |
| Person | 4203 South Dr, New Iberia, LA 70563 |
| Phone Number | 337-364-7145 |
| Possible Relatives |
Christopher J Patton Icle E Patton Sr Joea Patton |
| Previous Address | 1318 Andre St, New Iberia, LA 70563 |
| Name / Names | Joe L Patton |
|---|---|
| Age | N/A |
| Person | 5550 W QUINCY ST, CHICAGO, IL 60644 |
| Name / Names | Joe Patton |
|---|---|
| Age | N/A |
| Person | 322 PIER A, NAPLES, FL 34112 |
| Phone Number | 239-732-6430 |
| Name / Names | Joe H Patton |
|---|---|
| Age | N/A |
| Person | 641 E 84TH ST, INDIANAPOLIS, IN 46240 |
| Phone Number | 317-257-1228 |
| Name / Names | Joe E Patton |
|---|---|
| Age | N/A |
| Person | 319 Meridian St, Nashville, TN 37207 |
| Possible Relatives | Earline H Patton |
| Previous Address |
645 7th St, Nashville, TN 37206 614 6th St, Nashville, TN 37206 |
| Name / Names | Joe Patton |
|---|---|
| Age | N/A |
| Person | 1321 W GLEN PARK AVE, GRIFFITH, IN 46319 |
| Name / Names | Joe A Patton |
|---|---|
| Age | N/A |
| Person | 4059 DEER RUN N, WARSAW, IN 46582 |
| Name / Names | Joe L Patton |
|---|---|
| Age | N/A |
| Person | PO BOX 224, GRAY, GA 31032 |
| Name / Names | Joe Patton |
|---|---|
| Age | N/A |
| Person | 3199 SW 174TH AVE, DUNNELLON, FL 34432 |
| Name / Names | Joe P Patton |
|---|---|
| Age | N/A |
| Person | 20671 POND PASTURE RD, WINSLOW, AR 72959 |
| Name / Names | Joe J Patton |
|---|---|
| Age | N/A |
| Person | 840 PISGAH RD, POTTSVILLE, AR 72858 |
| Name / Names | Joe T Patton |
|---|---|
| Age | N/A |
| Person | 6503 E 12TH AVE, ANCHORAGE, AK 99504 |
| Name / Names | Joe A Patton |
|---|---|
| Age | N/A |
| Person | 105 Libby Hall, Boulder, CO 80310 |
| Name / Names | Joe Patton |
|---|---|
| Age | N/A |
| Person | 204 WESTERN DR, WINONA LAKE, IN 46590 |
| Phone Number | 574-267-8911 |
| Name / Names | Joe A Patton |
|---|---|
| Age | N/A |
| Person | 7166 MOUNT MORIAH RD, NINEVEH, IN 46164 |
| Phone Number | 317-878-5757 |
| Name / Names | Joe E Patton |
|---|---|
| Age | N/A |
| Person | 631 AUTUMN LEAF CIR, MCDONOUGH, GA 30253 |
| Phone Number | 770-957-1680 |
| Name / Names | Joe Patton |
|---|---|
| Age | N/A |
| Person | 114 S PRAIRIE ST, BETHALTO, IL 62010 |
| Phone Number | 618-377-7000 |
| Name / Names | Joe Patton |
|---|---|
| Age | N/A |
| Person | 3915 MAIN ST, KEOKUK, IA 52632 |
| Phone Number | 319-524-3238 |
| Name / Names | Joe L Patton |
|---|---|
| Age | N/A |
| Person | 180 LEE DR, GRAY, GA 31032 |
| Phone Number | 478-986-3891 |
| Name / Names | Joe Patton |
|---|---|
| Age | N/A |
| Person | 118 HARBOR POINT ST, PORT ORANGE, FL 32127 |
| Phone Number | 386-767-6673 |
| Name / Names | Joe W Patton |
|---|---|
| Age | N/A |
| Person | 10909 W COGGINS DR, SUN CITY, AZ 85351 |
| Phone Number | 623-974-3420 |
| Name / Names | Joe B Patton |
|---|---|
| Age | N/A |
| Person | 2 FENCHURCH LN, BELLA VISTA, AR 72715 |
| Phone Number | 479-876-7133 |
| Name / Names | Joe E Patton |
|---|---|
| Age | N/A |
| Person | 3010 BROOK MANOR AVE NW, HUNTSVILLE, AL 35816 |
| Phone Number | 256-539-2410 |
| Name / Names | Joe P Patton |
|---|---|
| Age | N/A |
| Person | 1003 EUCLID AVE, BIRMINGHAM, AL 35213 |
| Phone Number | 205-414-9338 |
| Name / Names | Joe E Patton |
|---|---|
| Age | N/A |
| Person | 1410 Chester Ave, Nashville, TN 37206 |
| Phone Number | 615-226-2414 |
| Name / Names | Joe E Patton |
|---|---|
| Age | N/A |
| Person | 631 AUTUMN LEAF CIR, MCDONOUGH, GA 30253 |
| Name / Names | Joe Ingeborg Patton |
|---|---|
| Age | N/A |
| Person | 12 Audubon Pl, Port Neches, TX 77651 |
| Phone Number | 409-724-2313 |
| Possible Relatives | Joseph R Patton |
| Name / Names | Joe Patton |
|---|---|
| Age | N/A |
| Person | 9333 RACHEL CT, TINLEY PARK, IL 60487 |
| Phone Number | 708-873-1505 |
| Name / Names | Joe D Patton |
|---|---|
| Age | N/A |
| Person | 2137 E 400 N, RENSSELAER, IN 47978 |
| Business Name | Tricom Inc |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | GA |
| Address | 1626 Riesling Dr Dacula GA 30019-7730 |
| Industry | Engineering, Management, Accounting, Research and Related Industries (Services) |
| SIC Code | 8748 |
| SIC Description | Business Consulting, Nec |
| Phone Number | 770-237-5888 |
| Business Name | The Westervelt Company |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | AL |
| Address | 1400 Jack Warner Pkwy NE, Tuscaloosa, AL |
| Phone Number | |
| [email protected] | |
| Title | Assistant VP HR |
| Business Name | Superior Vault |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | AL |
| Address | P.O. BOX 5205 Birmingham AL 35207-0205 |
| Industry | Clay, Concrete, Glass and Stone Products (Products) |
| SIC Code | 3272 |
| SIC Description | Concrete Products, Nec |
| Phone Number | 205-251-3548 |
| Number Of Employees | 4 |
| Annual Revenue | 166600 |
| Business Name | SAGE SCHOOL, INC. |
|---|---|
| Person Name | Joe Arthur Patton |
| Position | registered agent |
| State | GA |
| Address | 1560 Azalea Drive, Lawrenceville, GA 30043 |
| Business Contact Type | CFO |
| Model Type | Corp |
| Locale | Domestic |
| Qualifier | NonProfit |
| Effective Date | 2009-12-03 |
| Entity Status | Active/Noncompliance |
| Type | CFO |
| Business Name | Patton Transportation Inc |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | TX |
| Address | P.O. BOX 509 Uvalde TX 78802-0509 |
| Industry | Motor Freight Transportation (Transportation) |
| SIC Code | 4212 |
| SIC Description | Local Trucking, Without Storage |
| Phone Number | 830-278-6667 |
| Business Name | Patton Consultant Inc |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | SC |
| Address | 36 Blue Heron Pt Hilton Head Isle SC 29926-1209 |
| Industry | Engineering, Management, Accounting, Research and Related Industries (Services) |
| SIC Code | 8742 |
| SIC Description | Management Consulting Services |
| Phone Number | 843-689-6650 |
| [email protected] | |
| Number Of Employees | 1 |
| Annual Revenue | 166600 |
| Website | www.pattonconsultants.com |
| Business Name | Patton & Patton Personal Injury Lawyers |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | KS |
| Address | 3601 SW 29th #118, Topeka, 66614 KS |
| Phone Number | |
| [email protected] |
| Business Name | Patton & Patton Chartered Attorneys at Law |
|---|---|
| Person Name | JOE PATTON |
| Position | company contact |
| State | KS |
| Address | 3601 SW 29th St, Topeka, KS 66614 |
| SIC Code | 821103 |
| Phone Number | |
| [email protected] |
| Business Name | Patton & Patton Chartered Attorneys at Law |
|---|---|
| Person Name | JOE PATTON |
| Position | company contact |
| State | KS |
| Address | 3601 SW 29th St, TOPEKA, 66612 KS |
| Phone Number | |
| [email protected] |
| Business Name | Patton & Patton |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | KS |
| Address | 3601 SW 29th St # 118 Topeka KS 66614-2049 |
| Industry | Legal Services (Services) |
| SIC Code | 8111 |
| SIC Description | Legal Services |
| Phone Number | 785-273-4330 |
| Number Of Employees | 2 |
| Annual Revenue | 344020 |
| Website | www.joepatton.com |
| Business Name | Jiffy Lube |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | MI |
| Address | 17706 Plymouth Rd Detroit MI 48277-0001 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7549 |
| SIC Description | Automotive Services, Nec |
| Phone Number | 313-273-6211 |
| Business Name | HOJO, INC. |
|---|---|
| Person Name | JOE PATTON |
| Position | registered agent |
| State | GA |
| Address | 1521 SMITHWOOD DR, MARIETTA, GA 30066 |
| Business Contact Type | Secretary |
| Model Type | Corp |
| Locale | Domestic |
| Qualifier | ForProfit |
| Effective Date | 1998-04-14 |
| End Date | 2002-11-09 |
| Entity Status | Automated Administrative dissolution/Revocati |
| Type | Secretary |
| Business Name | Glitter Gee |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | GA |
| Address | 631 Autumn Leaf Cir Mcdonough GA 30253-8291 |
| Industry | Apparel and Accessory Stores (Stores) |
| SIC Code | 5621 |
| SIC Description | Women's Clothing Stores |
| Phone Number | 770-957-1680 |
| Number Of Employees | 2 |
| Annual Revenue | 220400 |
| Business Name | Glitter Gee |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | GA |
| Address | 400 Barrett Pkwy Kennesaw GA 30144-4917 |
| Industry | Apparel and Accessory Stores (Stores) |
| SIC Code | 5621 |
| SIC Description | Women's Clothing Stores |
| Phone Number | 770-957-1680 |
| Business Name | Fraud Hot Line |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | OH |
| Address | 1501 S Dixie Hwy Lima OH 45804-1844 |
| Industry | Legislative, Executive and General Government other than Finance (Government) |
| SIC Code | 9111 |
| SIC Description | Executive Offices |
| Phone Number | 419-228-2120 |
| Business Name | Farm Bureau Insurance Services |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | MO |
| Address | P.O. BOX 367 Mount Vernon MO 65712-0367 |
| Industry | Insurance Brokers, Agents and Services (Insurance) |
| SIC Code | 6411 |
| SIC Description | Insurance Agents, Brokers, And Service |
| Phone Number | 417-466-7679 |
| Business Name | Farm Bureau Insurance |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | MO |
| Address | 206 S Spring Park Blvd Mt Vernon MO 65712-1625 |
| Industry | Insurance Brokers, Agents and Services (Insurance) |
| SIC Code | 6411 |
| SIC Description | Insurance Agents, Brokers, And Service |
| Phone Number | 417-466-7679 |
| Number Of Employees | 2 |
| Annual Revenue | 287040 |
| Fax Number | 417-466-7050 |
| Business Name | FRANK FOSTER III FOUNDATION, INC. |
|---|---|
| Person Name | JOE PATTON |
| Position | registered agent |
| State | GA |
| Address | 1560 AZALEA DR, LAWRENCEVILLE, GA 30019 |
| Business Contact Type | Secretary |
| Model Type | Corp |
| Locale | Domestic |
| Qualifier | NonProfit |
| Effective Date | 1998-02-26 |
| End Date | 2011-08-20 |
| Entity Status | Admin. Dissolved |
| Type | Secretary |
| Business Name | Ed Patton Construction Inc |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | IN |
| Address | 1100 Wabash Ave Lafayette IN 47905-1061 |
| Industry | Building Construction - Operative Builders and General Contractors (Construction) |
| SIC Code | 1521 |
| SIC Description | Single-Family Housing Construction |
| Phone Number | 765-742-5080 |
| Number Of Employees | 20 |
| Annual Revenue | 4332960 |
| Fax Number | 765-429-5626 |
| Business Name | Day Construction & Maintenance |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | MI |
| Address | 120 Van Lieu St Charlotte MI 48813-1322 |
| Industry | Building Construction - Operative Builders and General Contractors (Construction) |
| SIC Code | 1521 |
| SIC Description | Single-Family Housing Construction |
| Phone Number | 517-543-9382 |
| Business Name | Cell-Church |
|---|---|
| Person Name | JOE PATTON |
| Position | company contact |
| State | TX |
| Address | ACU Station Box 29454, Abilene, TX 79699 |
| SIC Code | 999977 |
| Phone Number | |
| [email protected] |
| Business Name | Abia A Bargain Insurance Agent |
|---|---|
| Person Name | Joe Patton |
| Position | company contact |
| State | MO |
| Address | 141 Arnold Crossroads Ctr Arnold MO 63010-1402 |
| Industry | Insurance Brokers, Agents and Services (Insurance) |
| SIC Code | 6411 |
| SIC Description | Insurance Agents, Brokers, And Service |
| Phone Number | 636-287-2886 |
| Person Name | Joe Patton |
|---|---|
| Filing Number | 129241301 |
| Position | Director |
| State | TX |
| Address | 1451 COLQUITT RD APT 407, Terrell TX 75160 |
| Person Name | Joe Patton |
|---|---|
| Filing Number | 129241301 |
| Position | VP |
| State | TX |
| Address | 1451 COLQUITT RD APT 407, Terrell TX 75160 |
| Person Name | JOE PATTON |
|---|---|
| Filing Number | 801493388 |
| Position | DIRECTOR |
| State | TX |
| Address | 1720 SHOEBILL DR, LITTLE ELM TX 75068 |
| Person Name | JOE RAY PATTON |
|---|---|
| Filing Number | 112088900 |
| Position | PRESIDENT |
| State | TX |
| Address | P.O. BOX 509, UVALDE TX 78802 |
| Person Name | JOE RAY PATTON |
|---|---|
| Filing Number | 67979400 |
| Position | DIRECTOR |
| State | TX |
| Address | P.O. BOX 1135, UVALDE TX 78801 |
| Person Name | JOE RAY PATTON |
|---|---|
| Filing Number | 67979400 |
| Position | PRESIDENT |
| State | TX |
| Address | P.O. BOX 1135, UVALDE TX 78801 |
| Person Name | JOE RAY PATTON |
|---|---|
| Filing Number | 53374200 |
| Position | DIRECTOR |
| State | TX |
| Address | P.O. BOX 509, UVALDE TX 78842 |
| Person Name | JOE RAY PATTON |
|---|---|
| Filing Number | 53374200 |
| Position | PRESIDENT |
| State | TX |
| Address | P.O. BOX 509, UVALDE TX 78842 |
| Person Name | Joe M Patton |
|---|---|
| Filing Number | 32614601 |
| Position | Pastor |
| State | TX |
| Address | 3737 CR 405, Mckinney TX 75071 |
| Person Name | JOE PATTON |
|---|---|
| Filing Number | 801493388 |
| Position | MANAGER |
| State | TX |
| Address | 1720 SHOEBILL DR, LITTLE ELM TX 75068 |
| Person Name | JOE RAY PATTON |
|---|---|
| Filing Number | 112088900 |
| Position | DIRECTOR |
| State | TX |
| Address | P.O. BOX 509, UVALDE TX 78802 |
| State | OR |
|---|---|
| Calendar Year | 2017 |
| Employer | City of Tigard |
| Name | Patton Joe |
| Annual Wage | $52,065 |
| State | OR |
|---|---|
| Calendar Year | 2016 |
| Employer | City Of Tigard |
| Name | Patton Joe |
| Annual Wage | $48,813 |
| State | OR |
|---|---|
| Calendar Year | 2015 |
| Employer | City Of Tigard |
| Job Title | Sr Admin Specialist |
| Name | Patton Joe D |
| Annual Wage | $46,803 |
| State | NM |
|---|---|
| Calendar Year | 2018 |
| Employer | Village of House |
| Job Title | Council Member |
| Name | Patton Joe M |
| Annual Wage | $900 |
| State | NM |
|---|---|
| Calendar Year | 2017 |
| Employer | Village of House |
| Name | Patton Joe M |
| Annual Wage | $180 |
| State | NM |
|---|---|
| Calendar Year | 2016 |
| Employer | Village Of House |
| Name | Patton Joe M |
| Annual Wage | $900 |
| State | KS |
|---|---|
| Calendar Year | 2017 |
| Employer | City of Lenexa |
| Job Title | Pool Cashier |
| Name | Patton Joe A |
| Annual Wage | $1,030 |
| State | IN |
|---|---|
| Calendar Year | 2015 |
| Employer | State Of Indiana |
| Job Title | Program Director 1 |
| Name | Patton Joe |
| Annual Wage | $39,271 |
| Name | Joe Patton |
|---|---|
| Address | 1704 Montrose Dr Tuscaloosa AL 35405-3651 -3651 |
| Phone Number | 205-887-0036 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $250,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed College |
| Language | English |
| Name | Joe E Patton |
|---|---|
| Address | 17440 Paradise Shores Rd Brainerd MN 56401 -2252 |
| Phone Number | 218-764-2853 |
| Gender | Male |
| Date Of Birth | 1951-04-17 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 5 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 322 Pier A Naples FL 34112 -8110 |
| Phone Number | 239-732-6430 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $10,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed College |
| Language | English |
| Name | Joe H Patton |
|---|---|
| Address | 26202 Mandalay Cir Novi MI 48374 APT 39-2378 |
| Phone Number | 248-449-8390 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1963-09-20 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $250,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 2 |
| Range Of New Credit | 5001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 4271 E 850 N Rome City IN 46784 -9773 |
| Phone Number | 260-347-4673 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $15,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed College |
| Language | English |
| Name | Joe D Patton |
|---|---|
| Address | 3713 Hebron Rd Galax VA 24333 -5252 |
| Phone Number | 276-236-4140 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $30,000 |
| Estimated Net Worth | $50,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed Graduate School |
| Language | English |
| Name | Joe K Patton |
|---|---|
| Address | 1985 River Hill Rd Galax VA 24333 -5158 |
| Phone Number | 276-238-1267 |
| Gender | Male |
| Date Of Birth | 1970-04-08 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $25,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed Graduate School |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 4325 W Maypole Ave Chicago IL 60624 -1727 |
| Phone Number | 312-907-7919 |
| [email protected] | |
| Gender | Male |
| Ethnicity | African American 1 |
| Ethnic Group | All African American Ethnic Groups |
| Estimated Household Income | $20,000 |
| Estimated Net Worth | $25,000 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 14 Chambers Rd Saint Louis MO 63137 -4110 |
| Phone Number | 314-868-1484 |
| Mobile Phone | 314-868-1484 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1942-02-03 |
| Ethnicity | African American 1 |
| Ethnic Group | All African American Ethnic Groups |
| Estimated Household Income | $40,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Joe H Patton |
|---|---|
| Address | 641 E 84th St Indianapolis IN 46240 -2221 |
| Phone Number | 317-257-1228 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1932-12-10 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $0 |
| Lines Of Credit Trade Counter | 2 |
| Education | Completed College |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | Po Box 603 Batson TX 77519 -0603 |
| Phone Number | 409-998-3261 |
| [email protected] | |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $25,000 |
| Estimated Net Worth | $5,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed College |
| Language | English |
| Name | Joe A Patton |
|---|---|
| Address | 4779 Sycamore St Lima OH 45807 -2404 |
| Phone Number | 419-339-3605 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1946-04-12 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $200,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 3 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed Graduate School |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 382 Patton Ln Pikeville TN 37367 -3434 |
| Phone Number | 423-533-2217 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $20,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 5 |
| Range Of New Credit | 1001 |
| Education | Completed College |
| Language | English |
| Name | Joe C Patton |
|---|---|
| Address | 12665 Sw Morrison St Beaverton OR 97005 -0732 |
| Phone Number | 503-643-0662 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $60,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed College |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 1211 E Center St Warsaw IN 46580 -3521 |
| Phone Number | 574-551-1764 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Education | Completed High School |
| Language | English |
| Name | Joe L Patton |
|---|---|
| Address | 52570 Winsome Ln Chesterfield MI 48051-3721 -2182 |
| Phone Number | 586-293-6252 |
| Gender | Male |
| Date Of Birth | 1972-12-29 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $60,000 |
| Estimated Net Worth | $100,000 |
| Range Of New Credit | 5001 |
| Education | Completed High School |
| Language | English |
| Name | Joe D Patton |
|---|---|
| Address | 2858 Cairo Bend Rd Lebanon TN 37087 -7432 |
| Phone Number | 615-444-7427 |
| Mobile Phone | 615-405-7803 |
| Gender | Male |
| Date Of Birth | 1935-09-26 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $35,000 |
| Estimated Net Worth | $0 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed High School |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 1415 12th St Highland IL 62249-1931 -1931 |
| Phone Number | 618-654-9050 |
| Gender | Male |
| Date Of Birth | 1931-06-18 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $25,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 5 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 5550 W Quincy St Chicago IL 60644 -4236 |
| Phone Number | 773-287-9278 |
| Mobile Phone | 773-865-9331 |
| [email protected] | |
| Gender | Male |
| Ethnicity | African American 1 |
| Ethnic Group | All African American Ethnic Groups |
| Estimated Household Income | $30,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 4 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed High School |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 3546 Sw Summerwood Ct Topeka KS 66614 -3517 |
| Phone Number | 785-267-0116 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $50,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 1717 Sw 6th St Blue Springs MO 64014 -3970 |
| Phone Number | 816-244-1632 |
| Mobile Phone | 816-244-1632 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $10,000 |
| Estimated Net Worth | $100,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed College |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 306 SE Kingscross Rd Blue Springs MO 64014-3731 -3731 |
| Phone Number | 816-820-0596 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $100,000 |
| Range Of New Credit | 5001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Joe S Patton |
|---|---|
| Address | 615 Nw Albatross Dr Grain Valley MO 64029 -7325 |
| Phone Number | 816-847-2077 |
| Gender | Male |
| Date Of Birth | 1934-07-18 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $45,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 3001 |
| Education | Completed High School |
| Language | English |
| Name | Joe B Patton |
|---|---|
| Address | 735 Glen Abbey Dr Mansfield TX 76063 -3703 |
| Phone Number | 817-477-4807 |
| Mobile Phone | 817-675-2259 |
| Gender | Male |
| Date Of Birth | 1928-09-13 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $65,000 |
| Estimated Net Worth | $0 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed College |
| Language | English |
| Name | Joe Patton |
|---|---|
| Address | 4772 W Saint Ignace Rd Hessel MI 49745 -9210 |
| Phone Number | 906-484-3726 |
| Gender | Male |
| Date Of Birth | 1978-01-09 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $25,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | PATTON, JOE |
|---|---|
| Amount | 10000.00 |
| To | PATTON, JOE |
| Year | 2006 |
| Application Date | 2006-07-05 |
| Contributor Occupation | CANDIDATE |
| Recipient Party | R |
| Recipient State | KS |
| Seat | state:lower |
| Address | 3546 SW SUMMERWOOD CT TOPEKA KS |
| Name | PATTON, JOE |
|---|---|
| Amount | 2754.95 |
| To | PATTON, JOE |
| Year | 2004 |
| Application Date | 2004-09-15 |
| Recipient Party | R |
| Recipient State | KS |
| Seat | state:upper |
| Name | PATTON, JOE |
|---|---|
| Amount | 2000.00 |
| To | PATTON, JOE |
| Year | 2006 |
| Application Date | 2005-10-06 |
| Contributor Occupation | ATTORNEY/CANDIDATE |
| Recipient Party | R |
| Recipient State | KS |
| Seat | state:lower |
| Address | 3546 SW SUMMERWOOD CT TOPEKA KS |
| Name | PATTON, JOE |
|---|---|
| Amount | 1680.00 |
| To | KANSAS REPUBLICAN PARTY |
| Year | 20008 |
| Application Date | 2008-08-03 |
| Recipient Party | R |
| Recipient State | KS |
| Committee Name | KANSAS REPUBLICAN PARTY |
| Address | 3546 SW SUMMERWOOD CT TOPEKA KS |
| Name | PATTON, JOE |
|---|---|
| Amount | 1250.00 |
| To | Kansas Republican State Cmte |
| Year | 2008 |
| Transaction Type | 15 |
| Filing ID | 28991629403 |
| Application Date | 2008-06-26 |
| Contributor Occupation | ATTORNEY |
| Contributor Employer | SELF |
| Contributor Gender | M |
| Recipient Party | R |
| Committee Name | Kansas Republican State Cmte |
| Address | 3546 SW Summerwood Ct TOPEKA KS |
| Name | PATTON, JOE |
|---|---|
| Amount | 500.00 |
| To | CRIST, CHARLIE & KOTTKAMP, JEFF |
| Year | 2006 |
| Application Date | 2006-06-30 |
| Contributor Occupation | TEACHER |
| Recipient Party | R |
| Recipient State | FL |
| Seat | state:governor |
| Address | 5354 ARCHSTONE DR APT 304 TAMPA FL |
| Name | PATTON, JOE E JR |
|---|---|
| Amount | 250.00 |
| To | Atlas Air Worldwide |
| Year | 2012 |
| Transaction Type | 15 |
| Filing ID | 12970525570 |
| Application Date | 2012-02-29 |
| Contributor Occupation | flight mechanic/tech rep |
| Contributor Employer | Atlas Air, Inc |
| Contributor Gender | M |
| Committee Name | Atlas Air Worldwide |
| Address | 100 Burkwood Court FAYETTEVILLE GA |
| Name | PATTON, JOE |
|---|---|
| Amount | 250.00 |
| To | Sarah H. Steelman (R) |
| Year | 2012 |
| Transaction Type | 15 |
| Filing ID | 11020201944 |
| Application Date | 2011-03-31 |
| Organization Name | Patton & Patton |
| Contributor Gender | M |
| Recipient Party | R |
| Recipient State | MO |
| Committee Name | Steelman for US Senate |
| Seat | federal:senate |
| Name | PATTON, JOE |
|---|---|
| Amount | 150.00 |
| To | SCHMIDT, VICKI |
| Year | 2004 |
| Application Date | 2004-10-02 |
| Recipient Party | R |
| Recipient State | KS |
| Seat | state:upper |
| Name | PATTON, JOE |
|---|---|
| Amount | 100.00 |
| To | NICHOLSON, FLOYD |
| Year | 20008 |
| Application Date | 2008-10-30 |
| Contributor Occupation | CEO/HUMAN RESOURCE COMMISSION |
| Recipient Party | D |
| Recipient State | SC |
| Seat | state:upper |
| Address | 232 N HOSPITAL ST GREENWOOD SC |
| Name | PATTON, JOE |
|---|---|
| Amount | 100.00 |
| To | NICHOLSON, FLOYD |
| Year | 20008 |
| Application Date | 2008-05-01 |
| Contributor Occupation | CEO/HUMAN RESOURCE COMMISSION |
| Recipient Party | D |
| Recipient State | SC |
| Seat | state:upper |
| Address | 232 HOSPITAL ST N GREENWOOD SC |
| Name | PATTON, JOE |
|---|---|
| Amount | -2000.00 |
| To | PATTON, JOE |
| Year | 2006 |
| Application Date | 2006-01-04 |
| Recipient Party | R |
| Recipient State | KS |
| Seat | state:lower |
| Address | 3546 SW SUMMERWOOD CT TOPEKA KS |
| Name | PATTON, JOE |
|---|---|
| Amount | -10000.00 |
| To | PATTON, JOE |
| Year | 2006 |
| Application Date | 2006-07-21 |
| Recipient Party | R |
| Recipient State | KS |
| Seat | state:lower |
| Address | 3546 SW SUMMERWOOD CT TOPEKA KS |
| Name | PATTON PAM VAN & JOE VAN |
|---|---|
| Address | 2316 Goodwood Boulevard Smyrna GA |
| Value | 35000 |
| Landvalue | 35000 |
| Buildingvalue | 202640 |
| Type | Residential; Lots less than 1 acre |
| Name | JOE P PATTON |
|---|---|
| Address | 2105 Condolea Circle Leawood KS |
| Value | 3565 |
| Landvalue | 3565 |
| Buildingvalue | 17457 |
| Name | JOE L PATTON & MYRTLE M PATTON |
|---|---|
| Address | 1216 N Lloyd Drive Midwest City OK |
| Value | 961 |
| Landarea | 61,419 square feet |
| Type | Residential |
| Price | 8000 |
| Name | JOE & GEORGIA PATTON |
|---|---|
| Address | 5550 W Quincy Street Chicago IL 60644 |
| Landarea | 3,720 square feet |
| Airconditioning | No |
| Basement | Full and Unfinished |
| Name | JOE PATTON |
|---|---|
| Type | Independent Voter |
| State | TN |
| Address | 1236 LIBERTY PIKE, BELL BUCKLE, TN 37020 |
| Phone Number | 931-216-8727 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Democrat Voter |
| State | FL |
| Address | 2980 COLLINS AVENUE, SAINT AUGUSTINE, FL 32084 |
| Phone Number | 904-829-1017 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Voter |
| State | FL |
| Address | 24150 LANDING DRIVE, LUTZ, FL 33559 |
| Phone Number | 813-909-1521 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Independent Voter |
| State | VA |
| Address | 591 WALLACE ST, WARSAW, VA 22572 |
| Phone Number | 804-513-3044 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Independent Voter |
| State | MO |
| Address | 1408 SCHUPBACH RD, CLEVER, MO 65631 |
| Phone Number | 417-234-7648 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Voter |
| State | CO |
| Address | 1536 WILIIAMS ST. APT. 103, DENVER, CO 80218 |
| Phone Number | 405-570-3667 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Independent Voter |
| State | FL |
| Address | 3199 SW 174TH AVE, DUNNELLON, FL 34432 |
| Phone Number | 352-322-1130 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Voter |
| State | IN |
| Address | 1648 REED RD, FORT WAYNE, IN 46815 |
| Phone Number | 317-997-6455 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Voter |
| State | MO |
| Address | 1098 DEBORAH DR, ARNOLD, MO 63010 |
| Phone Number | 314-221-4141 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Type | Independent Voter |
| State | CO |
| Address | 3650 W 84TH LOWELL, WESTMINSTER, CO 80031 |
| Phone Number | 303-458-1975 |
| Email Address | [email protected] |
| Name | JOE PATTON |
|---|---|
| Car | GMC TERRAIN |
| Year | 2011 |
| Address | 615 NW Albatross Dr, Grain Valley, MO 64029-7325 |
| Vin | 2CTALWEC0B6440624 |
| Name | Joe Patton |
|---|---|
| Car | CHRYSLER SEBRING |
| Year | 2007 |
| Address | 1012 Placid Dr, Mesquite, TX 75150-3035 |
| Vin | 1C3LC56R07N629444 |
| Name | JOE PATTON |
|---|---|
| Car | CHRYSLER TOWN AND COUNTRY |
| Year | 2007 |
| Address | 36 Blue Heron Pt, Hilton Head Island, SC 29926-1209 |
| Vin | 2A4GP54L57R304740 |
| Phone | 843-384-6232 |
| Name | JOE PATTON |
|---|---|
| Car | CHEVROLET SILVERADO 2500HD CLASSIC |
| Year | 2007 |
| Address | 2215 Aberdeen Way, Lafayette, IN 47909-9179 |
| Vin | 1GCHK23D47F108720 |
| Phone | 765-477-0556 |
| Name | JOE PATTON |
|---|---|
| Car | FORD EXPLORER |
| Year | 2008 |
| Address | 10316 Slope Ridge St, Las Vegas, NV 89131-1558 |
| Vin | 1FMEU63E08UA71378 |
| Name | JOE PATTON |
|---|---|
| Car | CHEVROLET IMPALA |
| Year | 2008 |
| Address | 215 Patton Cir, West Union, SC 29696-3311 |
| Vin | 2G1WT58K081340696 |
| Phone | 864-638-2703 |
| Name | Joe Patton |
|---|---|
| Car | DODGE RAM PICKUP 1500 |
| Year | 2008 |
| Address | 615 NW Albatross Dr, Grain Valley, MO 64029-7325 |
| Vin | 1D7HA16K08J198654 |
| Name | JOE PATTON |
|---|---|
| Car | CADILLAC STS |
| Year | 2008 |
| Address | 4271 E 850 N, Rome City, IN 46784-9773 |
| Vin | 1G6DW67V980102058 |
| Phone | 260-347-4673 |
| Name | JOE PATTON |
|---|---|
| Car | CHEVROLET AVALANCHE |
| Year | 2007 |
| Address | 14 Chambers Rd, Saint Louis, MO 63137-4110 |
| Vin | 3GNFK12367G274432 |
| Name | JOE PATTON |
|---|---|
| Car | BUICK ENCLAVE |
| Year | 2008 |
| Address | 1321 S Reece Rd, Goddard, KS 67052-9330 |
| Vin | 5GAEV237X8J289262 |
| Phone | 316-794-8257 |
| Name | JOE PATTON |
|---|---|
| Car | CHEVROLET MALIBU |
| Year | 2009 |
| Address | 511 Kristy Ct, Newport News, VA 23602-9024 |
| Vin | 1G1ZH57B79F114200 |
| Name | JOE PATTON |
|---|---|
| Car | CHEVROLET CAMARO |
| Year | 2010 |
| Address | 47 S CROWNPOINTE DR, JACKSON, MS 39211-2210 |
| Vin | 2G1FT1EW2A9109791 |
| Name | JOE PATTON |
|---|---|
| Car | HYUNDAI SONATA |
| Year | 2010 |
| Address | 600 TOMLINSON RD, LEBANON, TN 37087-1133 |
| Vin | 5NPET4AC2AH605560 |
| Name | JOE PATTON |
|---|---|
| Car | LINCOLN NAVIGATOR |
| Year | 2010 |
| Address | 2215 Aberdeen Way, Lafayette, IN 47909-9179 |
| Vin | 5LMJJ2J51AEJ01889 |
| Phone | 304-777-0514 |
| Name | JOE PATTON |
|---|---|
| Car | TOYOTA TUNDRA |
| Year | 2010 |
| Address | 309 S. APPLE, HOUSE, NM 88121 |
| Vin | 5TFUW5F12AX124129 |
| Phone | 575-279-6069 |
| Name | JOE PATTON |
|---|---|
| Car | MINI COOPER CLUBMAN |
| Year | 2011 |
| Address | 5510 N Suggs Dr, Memphis, TN 38120-2837 |
| Vin | WMWZG3C55BTY35389 |
| Phone | 901-680-0155 |
| Name | JOE PATTON |
|---|---|
| Car | FORD F-150 |
| Year | 2011 |
| Address | 14 Chambers Rd, Saint Louis, MO 63137-4110 |
| Vin | 1FTFW1ET3BFA61179 |
| Name | JOE PATTON |
|---|---|
| Car | MERCURY GRAND MARQUIS |
| Year | 2009 |
| Address | 2858 CAIRO BEND RD, LEBANON, TN 37087-7432 |
| Vin | 2MEHM75V59X600076 |
| Phone | 615-444-7427 |
| Name | JOE PATTON |
|---|---|
| Car | FORD EDGE |
| Year | 2007 |
| Address | 735 Glen Abbey Dr, Mansfield, TX 76063-3703 |
| Vin | 2FMDK39C57BA74254 |
| Phone | 817-477-4807 |
| Name | Patton, Joe |
|---|---|
| Domain | packofpattons.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2004-03-02 |
| Update Date | 2013-01-02 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 1560 Azalea Drive Lawrenceville GA 30043 |
| Registrant Country | UNITED STATES |
| Name | Joe Patton |
|---|---|
| Domain | crssolutionsgroup.com |
| Contact Email | [email protected] |
| Whois Sever | whois.register.com |
| Create Date | 2001-12-26 |
| Update Date | 2013-10-20 |
| Registrar Name | REGISTER.COM, INC. |
| Registrant Address | 10921 Reed Hartman Highway Suite 334 Cincinnati OH 45242 |
| Registrant Country | UNITED STATES |
| Name | Joe Patton |
|---|---|
| Domain | autoaccidentattorneykansas.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2012-01-21 |
| Update Date | 2012-12-18 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | joepattonforsenate.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2011-08-27 |
| Update Date | 2012-08-25 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | topekafamilylawyer.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2012-05-23 |
| Update Date | 2012-08-31 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | jlpatton.com |
| Contact Email | [email protected] |
| Whois Sever | whois.register.com |
| Create Date | 2001-12-19 |
| Update Date | 2013-10-21 |
| Registrar Name | REGISTER.COM, INC. |
| Registrant Address | 9040 Garden Arbor Drive Suite 204 Germantown TN 38138 |
| Registrant Country | UNITED STATES |
| Name | Joe Patton |
|---|---|
| Domain | joe-patton.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2011-08-27 |
| Update Date | 2013-06-28 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | accidentlawyerskansascity.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2012-06-22 |
| Update Date | 2012-12-13 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | joepatton.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 1997-02-27 |
| Update Date | 2011-06-03 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | motorcycleaccidentkansascity.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2012-09-25 |
| Update Date | 2012-12-17 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | accidentattorneyskansascity.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2012-06-22 |
| Update Date | 2012-12-17 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | topekaprobatelawyer.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2013-12-13 |
| Update Date | 2013-12-13 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | employmentlawattorney.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | autoaccidentlawyer.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | medicalmalpracticelawyerskansascity.com |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2012-09-16 |
| Update Date | 2012-12-17 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 7853541901 |
| Name | Joe Patton |
|---|---|
| Domain | workerscompensationattorney.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | workerscompensationlawyer.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | joepatton.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-15 |
| Update Date | 2013-04-16 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | autoaccidentattorney.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | kansasattorney.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | kansaslawyer.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | topekalawyer.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | topekapersonalinjurylaw.pro |
| Contact Email | [email protected] |
| Create Date | 2012-10-08 |
| Update Date | 2013-08-09 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | joepatton.biz |
| Contact Email | [email protected] |
| Create Date | 2006-03-14 |
| Update Date | 2013-03-04 |
| Registrar Name | MELBOURNE IT LTD |
| Registrant Address | 800 SW Jackson #1414 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | joe-patton.info |
| Contact Email | [email protected] |
| Create Date | 2011-08-27 |
| Update Date | 2013-06-28 |
| Registrar Name | Network Solutions, LLC (R122-LRMS) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | joepatton.info |
| Contact Email | [email protected] |
| Create Date | 2005-07-13 |
| Update Date | 2013-07-13 |
| Registrar Name | Melbourne IT, Ltd (R141-LRMS) |
| Registrant Address | 534 S. Kansas Ave #820 Topeka ks 66603 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | topekapersonalinjurylaw.net |
| Contact Email | [email protected] |
| Whois Sever | whois.networksolutions.com |
| Create Date | 2012-10-08 |
| Update Date | 2013-08-09 |
| Registrar Name | NETWORK SOLUTIONS, LLC. |
| Registrant Address | ATTN insert domain name here care of Network Solutions PO Box 459 Drums PA 18222 |
| Registrant Country | UNITED STATES |
| Name | Joe Patton |
|---|---|
| Domain | joepatton.net |
| Contact Email | [email protected] |
| Whois Sever | whois.melbourneit.com |
| Create Date | 2005-07-13 |
| Update Date | 2013-07-14 |
| Registrar Name | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE |
| Registrant Address | 534 S. Kansas #820 Topeka ks 66603 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | topekaattorney.pro |
| Contact Email | [email protected] |
| Create Date | 2009-06-18 |
| Update Date | 2013-04-19 |
| Registrar Name | Network Solutions, LLC (R2353-PRO) |
| Registrant Address | 534 S. Kansas, Suite 820 Topeka KS 66612 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17853541901 |
| Name | Joe Patton |
|---|---|
| Domain | tantrumshop.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2008-10-10 |
| Update Date | 2008-10-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 7645 Certitude ave Las Vegas Nevada 89131 |
| Registrant Country | UNITED STATES |