We have found 208 public records related to Jessica Sharp in 37 states . People found have 2 ethnicities: African American 1 and English. Education levels of people we have found are: Completed College, Completed Graduate School and Completed High School. All people found speak English language. There is 1 business registration records connected with Jessica Sharp in public record. This business is registered in Ohio state. This business is engaged in Eating and Drinking Establishments (Food) industry. There are 60 profiles of government employees in our database. People found have eighteen different job titles. Most of them are employed as Teacher. These employees work in eighteen different states. Most of them work in Texas state. Average wage of employees is $33,942.
Name / Names | Jessica T Sharp |
---|---|
Age | 43 |
Birth Date | 1981 |
Person | 821 Volunteer, Knoxville, TN 37916 |
Possible Relatives |
Kathy Sharp Waldrop Amanda Serpas |
Previous Address | 10622 Eagle Glen,Knoxville, TN 37922 |
Name / Names | Jessica Molly Sharp |
---|---|
Age | 44 |
Birth Date | 1980 |
Also Known As | Jessica M Sandor |
Person | 9358 Monroe Ct #614, Crown Point, IN 46307 |
Phone Number | 219-926-6694 |
Possible Relatives |
Susan M Sandor John D Sandor Travis Lee Sharp Alex Sandor Mary Sandor Christopher Sandor Sue Sandor |
Previous Address | 839 Hunter Dr, Westville, IN 46391 |
[email protected] |
Name / Names | Jessica Flavia Sharp |
---|---|
Age | 44 |
Birth Date | 1980 |
Also Known As | Jessica Mitchell |
Person | 1501 Byron Ave, Deer Park, TX 77536 |
Phone Number | 713-779-8757 |
Possible Relatives |
Michaelallan Sharp Roxana Lissel Sharp Shannon Yale Mitchell Shawn M Sharp Natalie Sharp |
Previous Address |
2214 Green Valley Dr, Deer Park, TX 77536 4102 Waterford Cir #10, Louisville, KY 40207 7490 Beechnut St #536, Houston, TX 77074 10498 Fountain Lake Dr #723, Stafford, TX 77477 |
Name / Names | Jessica M Sharp |
---|---|
Age | 44 |
Birth Date | 1980 |
Person | 16837 23rd, Choctaw, OK 73020 |
Possible Relatives |
Barbara Jean Sharber Richard L Sharp |
Previous Address |
2620 Maupin,Choctaw, OK 73020 12850 Montana,Jones, OK 73049 341 PO Box,Jones, OK 73049 |
Available |
Name / Names | Jessica Jo Sharp |
---|---|
Age | 44 |
Birth Date | 1980 |
Person | 772 County Road 506, Shannon, MS 38868 |
Previous Address |
778 County Road 506,Shannon, MS 38868 55A RR 1,Shannon, MS 38868 RR 1,Shannon, MS 38868 228 County Road 520,Shannon, MS 38868 772 Ci,Shannon, MS 38868 772 Ci 506,Shannon, MS 38868 RR 1 CAPSHAW,Shannon, MS 38868 Route 1 Cato Tel,Shannon, MS 38868 55A PO Box,Shannon, MS 38868 |
Available |
Name / Names | Jessica J Sharp |
---|---|
Age | 45 |
Birth Date | 1979 |
Also Known As | Jessica J Braly |
Person | 80 Normacarol Rd, Oakland, TN 38060 |
Phone Number | 901-465-1661 |
Possible Relatives |
Richard H Sharp Freddie R Sharp Edwin Harris Braly Stephanie M Sharp Edwin Bralyjr Jonathan R Sharp Tim Braly Edwin Braly |
Previous Address |
2600 Silerton Rd, Henderson, TN 38340 3904 Waterfall Dr, Memphis, TN 38133 3760 Hawks Hollow Cv, Memphis, TN 38135 2616 Promedary, Memphis, TN 38133 3904 Waterfall Dr, Bartlett, TN 38133 |
Name / Names | Jessica L Sharp |
---|---|
Age | 45 |
Birth Date | 1979 |
Person | 70 Gold, Rochester, NY 14620 |
Possible Relatives |
Patricia A Sharp Robert G Sharp Dennis O Sharpe Andrea L Sharp R Sharp |
Previous Address |
1307 University City,Blacksburg, VA 24060 412 6th,Millville, NJ 08332 166 Milburn,Rochester, NY 14607 |
Name / Names | Jessica D Sharp |
---|---|
Age | 48 |
Birth Date | 1976 |
Person | 4045 Oak Haven, Sevierville, TN 37876 |
Possible Relatives |
James Michael Sharp Donita R Sharp Rebecca J Sharp Joanne P Sharp |
Previous Address | 303 Jackson,Sevierville, TN 37862 |
Name / Names | Jessica M Sharp |
---|---|
Age | 48 |
Birth Date | 1976 |
Person | 1735 Hunter Brook, Yorktown Hts, NY 10598 |
Possible Relatives |
Jennifer Sharp Askew Justin P Sharp |
Previous Address |
8576 Chesapeake,Norfolk, VA 23503 1125 Graydon,Norfolk, VA 23507 468 Painter,Norfolk, VA 23505 1306 Melrose,Norfolk, VA 23508 7330 Kenmore,Norfolk, VA 23505 1700 College,Virginia Beach, VA 23453 906 Monarch,Virginia Beach, VA 23462 |
Name / Names | Jessica Halmond Sharp |
---|---|
Age | 49 |
Birth Date | 1975 |
Person | 119 Maple, Spring Lake, MI 49456 |
Possible Relatives |
Jennifer Sue Zlotnicki Robert Matthew Halmond Pamela Joyce Halmond Nicholas J Halmond Douglas David Sharp Pamela Lc Halmond Barbara J Sharp |
Previous Address |
1442 Griggs,Grand Rapids, MI 49507 4032 Woodland Creek,Grand Rapids, MI 49512 4039 Woodlawn,Grand Rapids, MI 49546 4038 Woodland Creek,Grand Rapids, MI 49512 4032 Woodland Creek,Kentwood, MI 49512 |
Name / Names | Jessica Lynn Sharp |
---|---|
Age | 49 |
Birth Date | 1975 |
Person | 18654 880 Rd, Park Hill, OK 74451 |
Possible Relatives |
Sherry Thompson Sherry E Sharp |
Previous Address |
6276 36th St #B, Tulsa, OK 74135 6276 36th St, Tulsa, OK 74135 10964 61st St #1723, Tulsa, OK 74133 2520 7th Ave #37, Stillwater, OK 74074 817 Hightower St, Stillwater, OK 74074 124 Brumley #7, Stillwater, OK 74074 35 University Pl #6, Stillwater, OK 74075 35 University Pl #2, Stillwater, OK 74075 72F PO Box, Okemah, OK 74859 78A PO Box, Okemah, OK 74859 78F PO Box, Okemah, OK 74859 |
Name / Names | Jessica B Sharp |
---|---|
Age | 50 |
Birth Date | 1974 |
Also Known As | Jessica B Hurst |
Person | 11500 Wallace Ave, Oklahoma City, OK 73162 |
Phone Number | 580-622-2977 |
Possible Relatives |
Sandra K Zellner Travis Mitchell Hurst Martin Andrew Sharp Billy L Sharp Rachelle Sharp |
Previous Address |
4617 57th St, Oklahoma City, OK 73122 5908 Paramount Dr, Oklahoma City, OK 73162 3800 Peniel Ave, Bethany, OK 73008 1 PO Box, Sulphur, OK 73086 3101 Chickasaw Trl, Sulphur, OK 73086 469 PO Box, Sulphur, OK 73086 477 RR Box, Sauphur, OK 73085 |
Name / Names | Jessica Leacria Sharp |
---|---|
Age | 52 |
Birth Date | 1972 |
Also Known As | J Sharp |
Person | 4005 Hampshire Blvd, Fort Worth, TX 76103 |
Phone Number | 817-413-8515 |
Possible Relatives |
Latrina Morshae Sharp Jessie R3d Sharp L A Sharp Sharee Sharp |
Previous Address |
821 Jefferson Ave, Fort Worth, TX 76104 9605 Wickersham Rd, Dallas, TX 75238 2820 Lana Cir, Fort Worth, TX 76140 801 Jefferson Ave, Fort Worth, TX 76104 4313 Pecos St, Fort Worth, TX 76119 |
Name / Names | Jessica R Sharp |
---|---|
Age | 55 |
Birth Date | 1969 |
Also Known As | Janna L Riddle |
Person | 8305 Trakia Ct, Louisville, KY 40219 |
Phone Number | 502-961-0331 |
Possible Relatives |
Sherri L Sharp James Andrew Sharp Robert B Sharp Connie G Riddle Toni Ruth Riddle Tinagay Riddle Kessler Marcia Evelyn Riddle Janna Sharp Mildred L Sharp |
Previous Address |
7711 Cecilia Way, Louisville, KY 40219 4305 Shady Villa Dr #43, Louisville, KY 40219 6307 Outer Loop, Louisville, KY 40219 7000 Green Manor Dr, Louisville, KY 40228 226 Nolin Rd, Sonora, KY 42776 7743 Brookview Dr #3, Louisville, KY 40214 8101 Sherry Lynn Ct #6, Louisville, KY 40228 1106 Walnut St, Upton, KY 42784 |
[email protected] |
Name / Names | Jessica L Sharp |
---|---|
Age | 56 |
Birth Date | 1968 |
Also Known As | Jessica Nicola |
Person | 2 Owl Ave, Massena, NY 13662 |
Phone Number | 315-483-2257 |
Possible Relatives |
Joel Maryanne Nicola Mary Anne Nicola Geraldeugene Sharp Lauire M Hammond L Sharp Dominic Nicola Eugene Sharp Anne Mary Nicola |
Previous Address |
8858 Ridge Rd, North Rose, NY 14516 8858 Ridge Rd, Sodus, NY 14551 Ridge Rd, Sodus, NY 14551 Ridge, Sodus, NY 14551 136 PO Box, Alton, NY 14413 |
Name / Names | Jessica M Sharp |
---|---|
Age | 62 |
Birth Date | 1962 |
Also Known As | Ronda G Sharp |
Person | 1154 Sharp Loop, Ft Necessity, LA 71243 |
Phone Number | 318-412-0764 |
Possible Relatives |
William G Sharp William G Sharp Trey Sharp Kasey Jo Sharp Jessica Mishelle Mcmurry Jr Wg Sharp |
Previous Address |
690 Carter St, Winnsboro, LA 71295 1154 Sharp Loop, Fort Necessity, LA 71243 1508 Bosworth St, Winnsboro, LA 71295 HC 62, Ft Necessity, LA 71243 |
[email protected] |
Name / Names | Jessica Lynn Sharp |
---|---|
Age | 62 |
Birth Date | 1962 |
Person | 1725 Southwest Blvd #903, Tulsa, OK 74107 |
Possible Relatives |
Jerry F Sharp Stephen Gregory Sharp David Aaron Sharp Mary Grace Sharp April Sharp |
Previous Address |
1408 Canton Ave, Tulsa, OK 74112 1620 12th St, Tulsa, OK 74120 1725 Southwest Blvd, Tulsa, OK 74107 1725 Southwest Blvd #BLVD70, Tulsa, OK 74107 1919 Norwood Ave, Tulsa, OK 74115 1919 Norwood Pl, Tulsa, OK 74115 4322 67th St #675, Tulsa, OK 74136 115 Ash St, Chelsea, OK 74016 1725 Bl 903, Tulsa, OK 74107 4652 Fulton Ave #110, Tulsa, OK 74135 |
Name / Names | Jessica Sharp |
---|---|
Age | 63 |
Birth Date | 1961 |
Person | 5076 Ohio, Gary, IN 46409 |
Possible Relatives |
Craig Anderson Sharp Martin Alden Sharp Mary Sharp Crig A Sharp |
Previous Address |
9316 Mill Grove,Indian Trail, NC 28079 4709 Rocky River,Indian Trail, NC 28079 204 Houston,Monroe, NC 28112 112 Plov,Vallejo, CA 94590 7611 Surry,Indian Trail, NC 28079 1724 Blandford,Charlotte, NC 28262 |
Name / Names | Jessica Sharp |
---|---|
Age | 65 |
Birth Date | 1959 |
Person | 23018 County Hwy Zz, Richland Center, WI 53581 |
Possible Relatives |
Suzanne R Zillmer Don Sharp John R Sharp Suzanne R Sharp |
Previous Address |
23018 County Hwy Zz,Richland Ctr, WI 53581 23018 County,Richland Center, WI 53581 23018 County Highway Zz,Richland Center, WI 53581 314 Meadowview,Sparta, WI 54656 1319 Wisconsin,Sparta, WI 54656 Maple,Richland Center, WI 53581 25319 Maple Grove,Richland Center, WI 53581 Maple Grove,Richland Center, WI 53581 59 RR 3,Richland Center, WI 53581 RR 3 BALMORAL,Richland Center, WI 53581 40 PO Box,Sparta, WI 54656 59 PO Box,Richland Center, WI 53581 |
Name / Names | Jessica L Sharp |
---|---|
Age | 68 |
Birth Date | 1956 |
Also Known As | Joni L Sharp |
Person | 985 Brooke Stone Dr, Soddy Daisy, TN 37379 |
Phone Number | 423-451-0828 |
Possible Relatives |
Michael J Sharp Billye M Sharp Theresa C Sharp Richard M Sharp Michael A Sharp Jessica Lynn Sharp Warner Sharp Micky Sharp Joni L Sharp |
Previous Address |
6823 Crestwood Dr, Lawton, OK 73505 7216 Drakestone Blvd, Lawton, OK 73505 1259 Leaside Ln, Hixson, TN 37343 4421 Comet Trl #B, Hixson, TN 37343 341 Oak St, Montgomery, AL 36113 33266 PO Box, Fort Sill, OK 73503 |
Name / Names | Jessica H Sharp |
---|---|
Age | 69 |
Birth Date | 1955 |
Person | 310 Westminster, Charlottesville, VA 22901 |
Possible Relatives |
Richard A Sharp Kelli G Sharp |
Previous Address |
381 PO Box,Ghent, WV 25843 308 Maryland,Beckley, WV 25801 Flat Top,Ghent, WV 25843 106 Wickham,Beckley, WV 25801 310 Westminster,Charlottesville, VA 22901 Eagle School,Ghent, WV 25843 |
Available |
Name / Names | Jessica Dee Sharp |
---|---|
Age | 75 |
Birth Date | 1949 |
Person | 170 Old River, Beaufort, NC 28516 |
Possible Relatives |
Shennon Morris Sharp Robert Joesph Sharp Robert Vaughn Sharp |
Previous Address |
857 PO Box,Beaufort, NC 28516 857 RR 2,Beaufort, NC 28516 |
Available |
Name / Names | Jessica M Sharp |
---|---|
Age | N/A |
Person | 175 NACOOCHEE WAY, CANTON, GA 30114 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 7214 N 25TH DR, PHOENIX, AZ 85051 |
Phone Number | 602-626-7581 |
Name / Names | Jessica L Sharp |
---|---|
Age | N/A |
Person | 1710 GRANT AVE, COLORADO SPRINGS, CO 80909 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 84-713 MANUKU ST, WAIANAE, HI 96792 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 84-1001 LAHAINA ST, WAIANAE, HI 96792 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 65 BECKETT DR, DALLAS, GA 30132 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 1004 27TH AVE W, BRADENTON, FL 34205 |
Name / Names | Jessica M Sharp |
---|---|
Age | N/A |
Person | 485 STEWART ST, ENGLEWOOD, FL 34223 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 2127 N COLINS PL, HUACHUCA CITY, AZ 85616 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | PO BOX 372, CEDAR BLUFF, AL 35959 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 2146 COUNTY ROAD 60, FLORENCE, AL 35633 |
Name / Names | Jessica Daniel Sharp |
---|---|
Age | N/A |
Person | 259 Bunton, Kyle, TX 78640 |
Name / Names | Jessica A Sharp |
---|---|
Age | N/A |
Person | 305 HONEYSUCKLE TER, AUBURN, GA 30011 |
Phone Number | 770-307-0215 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 11672 Logan, Northglenn, CO 80233 |
Name / Names | Jessica C Sharp |
---|---|
Age | N/A |
Person | 1620 WESTGATE LN, MATTOON, IL 61938 |
Phone Number | 217-235-1462 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 115 AUSTIN AVE, WARNER ROBINS, GA 31088 |
Phone Number | 478-923-3081 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 1142 SUNSET POINT RD, CLEARWATER, FL 33755 |
Phone Number | 727-953-9674 |
Name / Names | Jessica L Sharp |
---|---|
Age | N/A |
Person | 206 SCHOOL HOUSE RD, OLD SAYBROOK, CT 6475 |
Phone Number | 860-388-3980 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 6601 E PRESIDIO ST, MESA, AZ 85215 |
Phone Number | 480-654-8020 |
Name / Names | Jessica D Sharp |
---|---|
Age | N/A |
Person | 28 WESTON CIR, GREENBRIER, AR 72058 |
Phone Number | 501-679-7119 |
Name / Names | Jessica J Sharp |
---|---|
Age | N/A |
Person | 660 W SARAHS WAY, WASILLA, AK 99654 |
Phone Number | 907-373-6856 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 2281 Albion, Toledo, OH 43606 |
Possible Relatives |
Lawrence E Sharp Michael H Sharp William Buster Sharp Rita Louise Sharp Larry E Sharp |
Name / Names | Jessica L Sharp |
---|---|
Age | N/A |
Person | 3745 39th St, Oklahoma City, OK 73119 |
Possible Relatives |
Alex A Sharp Mitts Sharp |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | 120 E NANCY LN, NASHVILLE, IL 62263 |
Phone Number | 618-464-0021 |
Name / Names | Jessica Sharp |
---|---|
Age | N/A |
Person | PO BOX 622, JEROME, ID 83338 |
Business Name | Mc Donald's |
---|---|
Person Name | Jessica Sharp |
Position | company contact |
State | OH |
Address | 7700 Reynolds Rd Mentor OH 44060-5321 |
Industry | Eating and Drinking Establishments (Food) |
SIC Code | 5812 |
SIC Description | Eating Places |
Phone Number | 440-946-9492 |
[email protected] | |
Annual Revenue | 1075200 |
Fax Number | 440-205-9901 |
State | TX |
---|---|
Calendar Year | 2018 |
Employer | University Of Texas Medical Branch - Galveston |
Name | Sharp Jessica L |
Annual Wage | $10,895 |
State | ND |
---|---|
Calendar Year | 2015 |
Employer | Jamestown 1 |
Job Title | Special Education Services |
Name | Sharp Jessica |
Annual Wage | $12 |
State | NY |
---|---|
Calendar Year | 2018 |
Employer | Village Of Sodus |
Name | Sharp Jessica L |
Annual Wage | $2,400 |
State | NY |
---|---|
Calendar Year | 2017 |
Employer | Village Of Sodus |
Name | Sharp Jessica L |
Annual Wage | $2,200 |
State | NY |
---|---|
Calendar Year | 2016 |
Employer | Village Of Sodus |
Name | Sharp Jessica L |
Annual Wage | $2,000 |
State | NY |
---|---|
Calendar Year | 2016 |
Employer | Town Of Sodus |
Name | Sharp Jessica L |
Annual Wage | $6,703 |
State | NY |
---|---|
Calendar Year | 2015 |
Employer | Village Of Sodus |
Name | Sharp Jessica L |
Annual Wage | $400 |
State | NY |
---|---|
Calendar Year | 2015 |
Employer | Town Of Sodus |
Name | Sharp Jessica L |
Annual Wage | $29,641 |
State | NJ |
---|---|
Calendar Year | 2018 |
Employer | Secaucus Town |
Name | Sharp Jessica |
Annual Wage | $23,336 |
State | NJ |
---|---|
Calendar Year | 2017 |
Employer | Secaucus Town |
Name | Sharp Jessica |
Annual Wage | $5,834 |
State | NE |
---|---|
Calendar Year | 2018 |
Employer | Health & Human Services - Agency 25 |
Job Title | Dd Service Coordinator |
Name | Sharp Jessica D |
Annual Wage | $35,464 |
State | LA |
---|---|
Calendar Year | 2018 |
Employer | Adult Probation And Parole |
Name | Sharp Jessica |
Annual Wage | $46,090 |
State | LA |
---|---|
Calendar Year | 2017 |
Employer | Adult Probation And Parole |
Job Title | Prob/Par Officer 3-Adult |
Name | Sharp Jessica |
Annual Wage | $40,733 |
State | LA |
---|---|
Calendar Year | 2016 |
Employer | Adult Probation And Parole |
Job Title | Adult |
Name | Sharp Jessica |
Annual Wage | $40,918 |
State | ND |
---|---|
Calendar Year | 2016 |
Employer | Jamestown High School |
Job Title | Aide/paraprofessional |
Name | Sharp Jessica |
Annual Wage | $13 |
State | IA |
---|---|
Calendar Year | 2016 |
Employer | School District Of Des Moines |
Name | Sharp Jessica R |
Annual Wage | $58,362 |
State | GA |
---|---|
Calendar Year | 2018 |
Employer | Valdosta State University |
Job Title | It Client Support Para/Pro |
Name | Sharp Jessica K |
Annual Wage | $17,755 |
State | GA |
---|---|
Calendar Year | 2017 |
Employer | Valdosta State University |
Job Title | It Client Support Para/Pro |
Name | Sharp Jessica K |
Annual Wage | $20,059 |
State | GA |
---|---|
Calendar Year | 2016 |
Employer | Valdosta State University |
Job Title | It Client Support Professional |
Name | Sharp Jessica K |
Annual Wage | $38,643 |
State | GA |
---|---|
Calendar Year | 2015 |
Employer | Valdosta State University |
Job Title | Technical Design Professional |
Name | Sharp Jessica K |
Annual Wage | $31,828 |
State | GA |
---|---|
Calendar Year | 2014 |
Employer | Valdosta State University |
Job Title | Technical Design Professional |
Name | Sharp Jessica K |
Annual Wage | $23,871 |
State | GA |
---|---|
Calendar Year | 2010 |
Employer | Hall County Board Of Education |
Job Title | Grade 3 Teacher |
Name | Sharp Jessica A |
Annual Wage | $5,749 |
State | FL |
---|---|
Calendar Year | 2017 |
Employer | Pasco Co School Board |
Name | Sharp Jessica B |
Annual Wage | $17,959 |
State | AR |
---|---|
Calendar Year | 2018 |
Employer | Mansfield School District |
Job Title | Elementary |
Name | Sharp Jessica |
Annual Wage | $38,475 |
State | AR |
---|---|
Calendar Year | 2018 |
Employer | Cabot School District |
Job Title | Elementary |
Name | Sharp Jessica |
Annual Wage | $47,730 |
State | AR |
---|---|
Calendar Year | 2017 |
Employer | Mansfield School District |
Name | Sharp Jessica E |
Annual Wage | $35,711 |
State | AR |
---|---|
Calendar Year | 2017 |
Employer | Cabot School District |
Name | Sharp Jessica D |
Annual Wage | $47,377 |
State | AR |
---|---|
Calendar Year | 2016 |
Employer | Mansfield School District |
Name | Sharp Jessica E |
Annual Wage | $31,964 |
State | IL |
---|---|
Calendar Year | 2017 |
Employer | Rowe Elementary School |
Name | Sharp Jessica |
Annual Wage | $45,450 |
State | AR |
---|---|
Calendar Year | 2016 |
Employer | Cabot School District |
Name | Sharp Jessica D |
Annual Wage | $46,548 |
State | OH |
---|---|
Calendar Year | 2013 |
Employer | Reynoldsburg City |
Job Title | Teacher Assignment |
Name | Sharp Jessica |
Annual Wage | $62,289 |
State | OH |
---|---|
Calendar Year | 2015 |
Employer | Buckeye Valley Local |
Job Title | Teacher Assignment |
Name | Sharp Jessica |
Annual Wage | $58,710 |
State | TX |
---|---|
Calendar Year | 2018 |
Employer | Texarkana Isd |
Job Title | Teacher |
Name | Sharp Jessica Jolene |
Annual Wage | $44,565 |
State | TX |
---|---|
Calendar Year | 2018 |
Employer | Humble Isd |
Job Title | Counselor |
Name | Sharp Jessica A |
Annual Wage | $65,912 |
State | TX |
---|---|
Calendar Year | 2018 |
Employer | College Of North Central Texas |
Job Title | Adjunct Faculty |
Name | Sharp Jessica L |
Annual Wage | $18,085 |
State | TX |
---|---|
Calendar Year | 2017 |
Employer | Texarkana Isd |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $44,365 |
State | TX |
---|---|
Calendar Year | 2017 |
Employer | Humble Isd |
Job Title | Counselor |
Name | Sharp Jessica |
Annual Wage | $64,464 |
State | TX |
---|---|
Calendar Year | 2017 |
Employer | College Of North Central Texas |
Job Title | Adjunct Faculty |
Name | Sharp Jessica L |
Annual Wage | $15,660 |
State | TX |
---|---|
Calendar Year | 2017 |
Employer | City Of Jersey Village |
Name | Sharp Jessica F |
Annual Wage | $8,320 |
State | TX |
---|---|
Calendar Year | 2016 |
Employer | Texarkana Isd |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $40,665 |
State | TX |
---|---|
Calendar Year | 2016 |
Employer | Slidell Isd |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $49,190 |
State | TX |
---|---|
Calendar Year | 2016 |
Employer | Humble Isd |
Job Title | Counselor |
Name | Sharp Jessica |
Annual Wage | $62,313 |
State | TX |
---|---|
Calendar Year | 2015 |
Employer | Texarkana Isd |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $39,464 |
State | TX |
---|---|
Calendar Year | 2015 |
Employer | Slidell Isd |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $48,310 |
State | OH |
---|---|
Calendar Year | 2014 |
Employer | Buckeye Valley Local |
Job Title | Teacher Assignment |
Name | Sharp Jessica |
Annual Wage | $58,710 |
State | TX |
---|---|
Calendar Year | 2015 |
Employer | Humble Isd |
Job Title | Teacher Facilitator |
Name | Sharp Jessica |
Annual Wage | $51,200 |
State | TN |
---|---|
Calendar Year | 2017 |
Employer | Hamilton County Schools |
Name | Sharp Jessica |
Annual Wage | $49,659 |
State | PA |
---|---|
Calendar Year | 2017 |
Employer | County of Allegheny Department Administrative Services |
Job Title | Administrative Assistant |
Name | Sharp Jessica |
Annual Wage | $44,795 |
State | PA |
---|---|
Calendar Year | 2016 |
Employer | County Of Allegheny |
Job Title | Administrative Assistant |
Name | Sharp Jessica |
Annual Wage | $38,631 |
State | MO |
---|---|
Calendar Year | 2017 |
Employer | Washington Middle |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $70,400 |
State | MO |
---|---|
Calendar Year | 2016 |
Employer | Earl Nance Sr. Elem. |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $38,250 |
State | MI |
---|---|
Calendar Year | 2017 |
Employer | County of Calhoun |
Job Title | Youth Specialist I |
Name | Sharp Jessica |
Annual Wage | $14,596 |
State | MD |
---|---|
Calendar Year | 2018 |
Employer | State Universities & Colleges |
Name | Sharp Jessica |
Annual Wage | $10 |
State | OK |
---|---|
Calendar Year | 2018 |
Employer | Burroughs Es |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $33,300 |
State | OK |
---|---|
Calendar Year | 2017 |
Employer | Burroughs Es |
Job Title | Teacher |
Name | Sharp Jessica |
Annual Wage | $32,900 |
State | OH |
---|---|
Calendar Year | 2017 |
Employer | Natural Resources |
Job Title | Campground Attendant |
Name | Sharp Jessica A |
Annual Wage | $11,499 |
State | OH |
---|---|
Calendar Year | 2017 |
Employer | Buckeye Valley Local |
Job Title | Teacher Assignment |
Name | Sharp Jessica |
Annual Wage | $58,710 |
State | OH |
---|---|
Calendar Year | 2016 |
Employer | Buckeye Valley Local |
Job Title | Teacher Assignment |
Name | Sharp Jessica |
Annual Wage | $58,710 |
State | TN |
---|---|
Calendar Year | 2018 |
Employer | Hamilton County Schools |
Name | Sharp Jessica |
Annual Wage | $52,186 |
State | AR |
---|---|
Calendar Year | 2015 |
Employer | Cabot School District |
Name | Sharp Jessica D |
Annual Wage | $46,517 |
Name | Jessica M Sharp |
---|---|
Address | 1607 Belmont Smith Rd Glen Saint Mary FL 32040 -5701 |
Telephone Number | 904-629-5258 |
Mobile Phone | 904-629-5258 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $55,000 |
Estimated Net Worth | $100,000 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Jessica N Sharp |
---|---|
Address | 110 W College St Butler IN 46721 -9761 |
Mobile Phone | 260-908-7008 |
[email protected] | |
Gender | Female |
Date Of Birth | 1989-07-05 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $45,000 |
Estimated Net Worth | $25,000 |
Range Of New Credit | 5001 |
Education | Completed High School |
Language | English |
Name | Jessica K Sharp |
---|---|
Address | 1409 Jackson St Bogalusa LA 70427 -1717 |
Mobile Phone | 985-294-9892 |
Gender | Female |
Date Of Birth | 1985-01-01 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $20,000 |
Estimated Net Worth | $5,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 1001 |
Education | Completed High School |
Language | English |
Name | Jessica A Sharp |
---|---|
Address | 514 County Road 2100e Casey IL 62420 -4224 |
Phone Number | 217-923-3292 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $50,000 |
Estimated Net Worth | $5,000 |
Range Of New Credit | 5001 |
Education | Completed High School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 18304 Craig St Prairieville LA 70769 -3915 |
Phone Number | 225-614-4732 |
Mobile Phone | 225-205-2070 |
[email protected] | |
Gender | Female |
Date Of Birth | 1977-11-23 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $45,000 |
Estimated Net Worth | $100,000 |
Range Of New Credit | 1001 |
Education | Completed High School |
Language | English |
Name | Jessica E Sharp |
---|---|
Address | 3362 Muerknoll Dr Troy MI 48084 -1604 |
Phone Number | 248-953-4688 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $200,000 |
Estimated Net Worth | $250,000 |
Lines Of Credit Trade Counter | 2 |
Range Of New Credit | 1001 |
Education | Completed High School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 1708 South Rd Cadiz KY 42211 -6621 |
Phone Number | 270-522-9344 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $25,000 |
Estimated Net Worth | $50,000 |
Range Of New Credit | 5001 |
Education | Completed Graduate School |
Language | English |
Name | Jessica A Sharp |
---|---|
Address | 20904 Theseus Ter Germantown MD 20876 -4170 |
Phone Number | 301-518-7407 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $65,000 |
Estimated Net Worth | $250,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 5001 |
Education | Completed High School |
Language | English |
Name | Jessica C Sharp |
---|---|
Address | 4 Buck Grove Est Mattoon IL 61938 -9335 |
Phone Number | 309-235-1462 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $45,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Jessica J Sharp |
---|---|
Address | 12209 Longtin St Southgate MI 48195-1766 APT 206-2699 |
Phone Number | 313-292-2375 |
Gender | Female |
Ethnicity | African American 1 |
Ethnic Group | All African American Ethnic Groups |
Estimated Household Income | $60,000 |
Estimated Net Worth | $100,000 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 8384 Smart St Detroit MI 48210 -1820 |
Phone Number | 313-622-4897 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $0 |
Estimated Net Worth | $5,000 |
Range Of New Credit | 5001 |
Education | Completed Graduate School |
Language | English |
Name | Jessica L Sharp |
---|---|
Address | 132 Sharp Mello Ln Olla LA 71465 -6914 |
Phone Number | 318-447-0476 |
[email protected] | |
Gender | Female |
Date Of Birth | 1982-01-01 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $25,000 |
Estimated Net Worth | $50,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 4069 Burnside Ln Nw Lilburn GA 30047 -2678 |
Phone Number | 404-925-5672 |
Mobile Phone | 404-925-5672 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $100,000 |
Estimated Net Worth | $250,000 |
Range Of New Credit | 5001 |
Education | Completed High School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 2730 E Alameda St Springfield MO 65804 -2721 |
Phone Number | 417-459-1253 |
Mobile Phone | 417-988-6316 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $45,000 |
Estimated Net Worth | $100,000 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Jessica L Sharp |
---|---|
Address | 22 Clark Ave Walpole MA 02081 -2817 |
Phone Number | 508-668-0139 |
Gender | Female |
Date Of Birth | 1982-03-23 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Net Worth | $100,000 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 19 Hillwood Dr Niantic CT 06357 -1824 |
Phone Number | 603-275-2540 |
[email protected] | |
Gender | Female |
Date Of Birth | 1981-11-23 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $100,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Jessica Sharp |
---|---|
Address | Po Box 301 Stanford KY 40484 -0301 |
Phone Number | 606-669-4286 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $15,000 |
Estimated Net Worth | $10,000 |
Range Of New Credit | 5001 |
Education | Completed Graduate School |
Language | English |
Name | Jessica H Sharp |
---|---|
Address | 119 Maple Ter Spring Lake MI 49456 -1717 |
Phone Number | 616-847-6529 |
[email protected] | |
Gender | Female |
Date Of Birth | 1972-06-02 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $60,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 2 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 840 Russell Ct Columbia IL 62236 -1548 |
Phone Number | 618-281-6046 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $75,000 |
Estimated Net Worth | $100,000 |
Range Of New Credit | 5001 |
Education | Completed High School |
Language | English |
Name | Jessica L Sharp |
---|---|
Address | 1710 Grant Ave Colorado Springs CO 80909 -2415 |
Phone Number | 719-473-8949 |
[email protected] | |
Gender | Female |
Date Of Birth | 1979-03-31 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $50,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 6 |
Range Of New Credit | Greater than $9,999 |
Education | Completed High School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 4953 E Us Highway 40 Greencastle IN 46135 APT 1390-8179 |
Phone Number | 765-526-2212 |
Telephone Number | 765-526-2212 |
Mobile Phone | 765-526-2212 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $75,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 2 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Jessica A Sharp |
---|---|
Address | 305 Honeysuckle Ter Auburn GA 30011 -3330 |
Phone Number | 770-307-0215 |
Mobile Phone | 404-219-1443 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $45,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 2 |
Range Of New Credit | 1001 |
Education | Completed High School |
Language | English |
Name | Jessica M Sharp |
---|---|
Address | 175 Nacoochee Way Canton GA 30114 -9020 |
Phone Number | 770-778-4434 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $65,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 5001 |
Education | Completed Graduate School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 400 S Moonlight Rd Gardner KS 66030 APT 37C-2517 |
Phone Number | 785-248-6704 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $15,000 |
Estimated Net Worth | $25,000 |
Lines Of Credit Trade Counter | 2 |
Range Of New Credit | 1001 |
Education | Completed Graduate School |
Language | English |
Name | Jessica D Sharp |
---|---|
Address | 1753 Farmview Dr Lexington KY 40515 -1363 |
Phone Number | 859-552-5181 |
[email protected] | |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $100,000 |
Estimated Net Worth | $50,000 |
Lines Of Credit Trade Counter | 1 |
Range Of New Credit | 501 |
Education | Completed College |
Language | English |
Name | Jessica J Sharp |
---|---|
Address | 27480 Hop Rd Caldwell ID 83607 -1103 |
Phone Number | 907-373-6856 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $75,000 |
Range Of New Credit | 501 |
Education | Completed High School |
Language | English |
Name | Jessica Sharp |
---|---|
Address | 8612 Robinson St Overland Park KS 66212 -1912 |
Phone Number | 913-645-3662 |
Gender | Female |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $75,000 |
Range Of New Credit | 5001 |
Education | Completed High School |
Language | English |
Name | SHARP, JESSICA |
---|---|
Amount | 35.00 |
To | OMALLEY, MARTIN (G) |
Year | 2010 |
Application Date | 2010-07-27 |
Recipient Party | D |
Recipient State | MD |
Seat | state:governor |
Address | 9451 FENS HOLLOW LAUREL MD |
Name | SHARP, JESSICA |
---|---|
Amount | 25.00 |
To | OMALLEY, MARTIN (G) |
Year | 2010 |
Application Date | 2010-08-09 |
Recipient Party | D |
Recipient State | MD |
Seat | state:governor |
Address | 9451 FENS HOLLOW LAUREL MD |
Name | SHARP HAROLD G JR & JESSICA M |
---|---|
Address | 1645 Belmont Smith Road Glen St. Mary FL |
Value | 9180 |
Landvalue | 9180 |
Buildingvalue | 164359 |
Landarea | 87,120 square feet |
Type | Residential Property |
Name | JESSICA SHARP |
---|---|
Address | 3305 Pinion Drive Plano TX 75023-7332 |
Value | 30000 |
Landvalue | 30000 |
Buildingvalue | 109900 |
Name | JESSICA SHARP |
---|---|
Address | 909 Chickesaw Lane Wylie TX |
Value | 30000 |
Landvalue | 30000 |
Buildingvalue | 68370 |
Name | JESSICA M SHARP |
---|---|
Address | 175 Nacoochee Way Canton GA 30114 |
Numberofbathrooms | 2 |
Bedrooms | 3 |
Numberofbedrooms | 3 |
Name | JESSICA A SHARP |
---|---|
Address | 12218 Sunlight Peak Lane Humble TX 77346 |
Value | 30887 |
Landvalue | 30887 |
Buildingvalue | 107023 |
Name | SHARP HAROLD G JR & JESSICA M |
---|---|
Physical Address | 1645, GLEN ST MARY, FL 32040 |
Ass Value Homestead | 173539 |
Just Value Homestead | 173539 |
County | Baker |
Year Built | 2011 |
Area | 2458 |
Applicant Status | Husband |
Co Applicant Status | Wife |
Land Code | Single Family |
Address | 1645, GLEN ST MARY, FL 32040 |
Name | JESSICA SHARP |
---|---|
Type | Republican Voter |
State | OK |
Address | 1002 G ST NW NONE, MIAMI, OK 74354 |
Phone Number | 918-961-2576 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Independent Voter |
State | FL |
Address | 1607 BELMONT SMITH RD, GLEN SAINT MARY, FL 32040 |
Phone Number | 904-629-5258 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | FL |
Address | 1607 BELMONT SMITH RD, GLEN SAINT MARY, FL 32040 |
Phone Number | 904-629-5257 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | IL |
Address | 158 VISTA TER, SYCAMORE, IL 60178 |
Phone Number | 815-895-2021 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Independent Voter |
State | HI |
Address | 84-713 A MANUKU ST, WAIANAE, HI 96792 |
Phone Number | 808-371-4870 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | UT |
Address | 935 E HIGHWAY 193 TRLR 137, LAYTON, UT 84040 |
Phone Number | 801-513-5523 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Republican Voter |
State | MN |
Address | 454 ANDOVER BLVD, ANDOVER, MN 55304 |
Phone Number | 763-355-5411 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Democrat Voter |
State | VA |
Address | 9407 SILVER METEOR CT, MANASSAS PARK, VA 20111 |
Phone Number | 703-296-8057 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Independent Voter |
State | OH |
Address | 1676 OAK ST, COLUMBUS, OH 43205 |
Phone Number | 614-251-0321 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | MS |
Address | 26 STANDARD HILL RD, VICKSBURG, MS 39183 |
Phone Number | 601-634-1868 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Independent Voter |
State | MO |
Address | 205 WEST STURGEON, WELLSVILLE, MO 63384 |
Phone Number | 573-684-2779 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Republican Voter |
State | OH |
Address | 6865 HIGHLAND GREENS DR APT 31, WEST CHESTER, OH 45069 |
Phone Number | 513-376-2842 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | KY |
Address | 4305 SHADY VILLA DR APT 43, OKOLONA, KY 40219 |
Phone Number | 502-821-8592 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | UT |
Address | 2740 BUTCH CASSIDY CT, PARK CITY, UT 84060 |
Phone Number | 435-649-5262 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | TN |
Address | 202 TRUE RD, SPRING CITY, TN 37381 |
Phone Number | 423-365-7033 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | OH |
Address | 1312 BROOKVIEW DR, TOLEDO, OH 43615 |
Phone Number | 419-870-8318 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Democrat Voter |
State | OH |
Address | 1743 GEORGIA AVE, TOLEDO, OH 43613 |
Phone Number | 419-475-7500 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | LA |
Address | P.O. BOX 2862, JENA, LA 71342 |
Phone Number | 318-447-0476 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | IN |
Address | 4733 AUBURN FRD, GREENWOOD, IN 46142 |
Phone Number | 317-979-9605 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Republican Voter |
State | NY |
Address | 635 AVERILL AVE, ROCHESTER, NY 14607 |
Phone Number | 315-730-5124 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Democrat Voter |
State | MI |
Address | 25921 COLGATE, INKSTER, MI 48141 |
Phone Number | 313-662-4653 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Independent Voter |
State | WY |
Address | 9 BLOCK 1 MOUNTAIN VIEW ESTATES, SARATOGA, WY 82331 |
Phone Number | 307-321-5002 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Independent Voter |
State | TX |
Address | 4006 MADISON DR., KILLEEN, TX 76543 |
Phone Number | 254-690-8062 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Voter |
State | MI |
Address | 12070 TIMBERLANE DR, STANWOOD, MI 49346 |
Phone Number | 231-480-4751 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Independent Voter |
State | MI |
Address | 12070 TIMBERLANE, STANWOOD, MI 49346 |
Phone Number | 231-480-4751 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Republican Voter |
State | IN |
Address | 845 ELK LN, WESTVILLE, IN 46391 |
Phone Number | 219-983-1915 |
Email Address | [email protected] |
Name | JESSICA SHARP |
---|---|
Type | Democrat Voter |
State | ID |
Address | 1285SLINCOLN39, JEROME, ID 83338 |
Phone Number | 208-316-2418 |
Email Address | [email protected] |
Name | Jessica L Sharp |
---|---|
Visit Date | 4/13/10 8:30 |
Appointment Number | U07588 |
Type Of Access | VA |
Appt Made | 7/2/13 0:00 |
Appt Start | 7/8/13 10:30 |
Appt End | 7/8/13 23:59 |
Total People | 5 |
Last Entry Date | 7/2/13 12:00 |
Meeting Location | WH |
Caller | MICHAEL |
Description | MakeAWish tour in Residence/Potus appt. Oval |
Release Date | 11/08/2013 08:00:00 AM +0000 |
Name | Jessica E Sharp |
---|---|
Visit Date | 4/13/10 8:30 |
Appointment Number | U43225 |
Type Of Access | VA |
Appt Made | 9/20/2011 0:00 |
Appt Start | 9/22/2011 8:30 |
Appt End | 9/22/2011 23:59 |
Total People | 363 |
Last Entry Date | 9/20/2011 9:23 |
Meeting Location | WH |
Caller | VISITORS |
Description | GROUP TOUR |
Release Date | 12/30/2011 08:00:00 AM +0000 |
Name | JESSICA L SHARP |
---|---|
Visit Date | 4/13/10 8:30 |
Appointment Number | U84134 |
Type Of Access | VA |
Appt Made | 3/3/10 15:26 |
Appt Start | 3/9/10 10:30 |
Appt End | 3/9/10 23:59 |
Total People | 372 |
Last Entry Date | 3/3/2010 |
Meeting Location | WH |
Caller | VISITORS |
Release Date | 06/25/2010 07:00:00 AM +0000 |
Name | JESSICA SHARP |
---|---|
Car | GMC YUKON |
Year | 2012 |
Address | 900 Sonoma Dr, McKinney, TX 75070-3775 |
Vin | 1GKS1EEF1CR308640 |
Phone | 214-578-9888 |
Name | Jessica Sharp |
---|---|
Car | HONDA ODYSSEY |
Year | 2007 |
Address | 5725 Lenox Ave, Lincoln, NE 68510-2120 |
Vin | 5FNRL384X7B057955 |
Phone | 402-489-4380 |
Name | JESSICA SHARP |
---|---|
Car | SATURN OUTLOOK |
Year | 2008 |
Address | 1180 JOHNSTON STATION RD, SUMMIT, MS 39666-9033 |
Vin | 5GZER237X8J250866 |
Name | JESSICA SHARP |
---|---|
Car | HONDA CR-V |
Year | 2008 |
Address | 3513 South Pointe Dr, Apex, NC 27539-9127 |
Vin | 5J6RE38758L003038 |
Name | JESSICA SHARP |
---|---|
Car | DODGE RAM PICKUP 1500 |
Year | 2008 |
Address | 7214 N 25th Dr, Phoenix, AZ 85051-6704 |
Vin | 1D7HU18218J135860 |
Name | JESSICA SHARP |
---|---|
Car | CHEVROLET SILVERADO 1500 |
Year | 2008 |
Address | 4924 PRESTONWOOD RD, PERRYSBURG, OH 43551-3140 |
Vin | 1GCEC19028Z307070 |
Name | JESSICA SHARP |
---|---|
Car | FORD EDGE |
Year | 2008 |
Address | 81 E Pattagansett Rd, Niantic, CT 06357-2346 |
Vin | 2FMDK48C28BA16451 |
Name | JESSICA SHARP |
---|---|
Car | CHEVROLET MALIBU |
Year | 2008 |
Address | PO Box 54, Vassar, KS 66543-0054 |
Vin | 1G1ZK57728F227466 |
Phone | 785-828-4711 |
Name | JESSICA SHARP |
---|---|
Car | DODGE RAM PICKUP 2500 |
Year | 2008 |
Address | PO Box 981, Saratoga, WY 82331-0981 |
Vin | 3D7KS29D98G243825 |
Phone | 307-326-5002 |
Name | JESSICA SHARP |
---|---|
Car | DODGE CHARGER |
Year | 2009 |
Address | 3619 CANADA DR, DALLAS, TX 75212-1209 |
Vin | 2B3KA33V69H562624 |
Name | JESSICA SHARP |
---|---|
Car | CHEVROLET TAHOE |
Year | 2007 |
Address | 3305 Pinion Dr, Plano, TX 75023-7332 |
Vin | 1GNFC13037R347466 |
Name | JESSICA SHARP |
---|---|
Car | NISSAN VERSA |
Year | 2009 |
Address | 4318 E Cordoba Cir, Georgetown, TX 78628-1612 |
Vin | 3N1BC11E69L447922 |
Name | JESSICA SHARP |
---|---|
Car | TOYOTA RAV4 |
Year | 2010 |
Address | 22 CLARK AVE, WALPOLE, MA 02081-2817 |
Vin | 2T3DK4DV5AW018497 |
Name | JESSICA SHARP |
---|---|
Car | TOYOTA FJ CRUISER |
Year | 2010 |
Address | 985 BROOKE STONE DR, SODDY DAISY, TN 37379-9124 |
Vin | JTEBU4BF6AK078077 |
Name | JESSICA SHARP |
---|---|
Car | FORD FOCUS |
Year | 2010 |
Address | 245 RIDGE RD, SHARPS CHAPEL, TN 37866-2507 |
Vin | 1FAHP3HN8AW247478 |
Name | JESSICA SHARP |
---|---|
Car | CHEVROLET COBALT |
Year | 2010 |
Address | 4005 HAMPSHIRE BLVD, FORT WORTH, TX 76103-3918 |
Vin | 1G1AD1F58A7183229 |
Name | JESSICA SHARP |
---|---|
Car | TOYOTA CAMRY |
Year | 2010 |
Address | 2536 County Highway 330, Nevada, OH 44849-9767 |
Vin | 4T1BF3EK9AU063333 |
Phone | 419-427-8539 |
Name | JESSICA SHARP |
---|---|
Car | HONDA ELEMENT |
Year | 2011 |
Address | 1212 16th St, Anacortes, WA 98221-2225 |
Vin | 5J6YH2H7XBL001404 |
Name | JESSICA SHARP |
---|---|
Car | KIA SORENTO |
Year | 2012 |
Address | 108 Courtney Dr, Manassas Park, VA 20111-2061 |
Vin | 5XYKTDA67CG209471 |
Phone | 703-853-3716 |
Name | JESSICA SHARP |
---|---|
Car | CHEVROLET SONIC |
Year | 2012 |
Address | 462 Clearview Ct, Orange Park, FL 32065-2293 |
Vin | 1G1JC5SH3C4155577 |
Phone | 573-528-2342 |
Name | JESSICA SHARP |
---|---|
Car | HYUNDAI SANTA FE |
Year | 2009 |
Address | 9828 Gilreath Rd, Chatham, IL 62629-8628 |
Vin | 5NMSH13E39H332025 |
Phone | 217-971-5674 |
Name | JESSICA SHARP |
---|---|
Car | FORD FREESTYLE |
Year | 2007 |
Address | 108 COURTNEY DR, MANASSAS PARK, VA 20111 |
Vin | 1FMDK051X7GA03398 |
Name | Jessica Sharp |
---|---|
Domain | livehealthylivehappylivewealthyliveisa.net |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-07-24 |
Update Date | 2013-07-24 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 35 St. Dennis Drive|Apt. 627 Toronto Ontario M3C 1G9 |
Registrant Country | CANADA |
Name | Jessica Sharp |
---|---|
Domain | livehealthylivehappylivewealthyliveisa.info |
Contact Email | [email protected] |
Create Date | 2013-07-24 |
Update Date | 2013-09-22 |
Registrar Name | GoDaddy.com, LLC (R171-LRMS) |
Registrant Address | 35 St. Dennis Drive Apt. 627 Toronto Ontario M3C 1G9 |
Registrant Country | CANADA |
Name | Jessica Sharp |
---|---|
Domain | livehealthylivehappylivewealthyliveisa.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-07-24 |
Update Date | 2013-07-24 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 35 St. Dennis Drive|Apt. 627 Toronto Ontario M3C 1G9 |
Registrant Country | CANADA |
Name | Jessica Sharp |
---|---|
Domain | jessicasharp.com |
Contact Email | [email protected] |
Whois Sever | whois.melbourneit.com |
Create Date | 2005-01-29 |
Update Date | 2013-11-20 |
Registrar Name | MELBOURNE IT, LTD. D/B/A INTERNET NAMES WORLDWIDE |
Registrant Address | 15872 bull run frisco TX 75035 |
Registrant Country | UNITED STATES |
Name | Jessica Sharp |
---|---|
Domain | heartlandresidential.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-09-18 |
Update Date | 2013-09-18 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1100 Branch Street Platte City Missouri 64079 |
Registrant Country | UNITED STATES |
Name | Jessica Sharp |
---|---|
Domain | cheekibooti.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-02-23 |
Update Date | 2013-02-23 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 103 Edgemont Estates Drive Calgary Alberta T3A 2M3 |
Registrant Country | CANADA |
Name | Jessica Sharp |
---|---|
Domain | optimumphysiques.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-07-05 |
Update Date | 2013-07-06 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 20 Sandhurst close|Brigadoon Perth Western Australia 6069 |
Registrant Country | AUSTRALIA |
Name | Jessica Sharp |
---|---|
Domain | annihil8clothingapparel.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-02-16 |
Update Date | 2013-02-16 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 20 Sandhurst Close Perth Western Australia 6069 |
Registrant Country | AUSTRALIA |
Name | Jessica Sharp |
---|---|
Domain | heartbenchfam.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2006-11-17 |
Update Date | 2011-11-15 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1250 Ward Ln Parma Idaho 83660 |
Registrant Country | UNITED STATES |
Name | JESSICA SHARP |
---|---|
Domain | nellieandelsie.com |
Contact Email | [email protected] |
Whois Sever | whois.enom.com |
Create Date | 2010-03-08 |
Update Date | 2013-10-14 |
Registrar Name | ENOM, INC. |
Registrant Address | PO BOX 19184|LONDON LONDON LONDON SE28 0WQ |
Registrant Country | UNITED KINGDOM |
Name | JESSICA SHARP |
---|---|
Domain | jessicasharpphotography.com |
Contact Email | [email protected] |
Whois Sever | whois.enom.com |
Create Date | 2010-08-06 |
Update Date | 2013-08-11 |
Registrar Name | ENOM, INC. |
Registrant Address | 42 PURBROOK ROAD|TADLEY BASINGSTOKE HAMPSHIRE RG26 4PR |
Registrant Country | UNITED KINGDOM |
Name | Jessica Sharp |
---|---|
Domain | themacromentors.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-06-17 |
Update Date | 2013-06-17 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 59 the parkway|Ellenbrook Perth Western Australia 6069 |
Registrant Country | AUSTRALIA |
Name | Jessica Sharp |
---|---|
Domain | pommirootravelthrough.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-04-13 |
Update Date | 2013-04-14 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 103 Edgemont Estates Drive Calgary Alberta T3A 2M3 |
Registrant Country | CANADA |