We have found 84 public records related to Gary Newland in 14 states . Ethnicity of all people found is English. Education levels of people we have found are: Completed High School, Completed Graduate School and Completed College. All people found speak English language. There are 5 business registration records connected with Gary Newland in public records. The businesses are registered in 2 states: UT and TX. The businesses are engaged in 3 industries: Wholesale Trade - Durable Goods (Products), Automotive Services, Parking And Repair (Automotive) and Membership Organizations (Organizations). We haven't found any government employees.
| Name / Names | Gary Joe Newland |
|---|---|
| Age | 50 |
| Birth Date | 1974 |
| Person | 9 Mi E 4 14 Mi Of, Medford e Side Rd, OK 73759 |
| Name / Names | Gary A Newland |
|---|---|
| Age | 53 |
| Birth Date | 1971 |
| Also Known As | Gary Newiand |
| Person | 3 PO Box, Libertyville, IL 60048 |
| Phone Number | 847-323-5734 |
| Possible Relatives |
Charles T Newland Susan A Newland |
| Previous Address |
121 Wilke Rd #101, Arlington Heights, IL 60005 1672 Park Ave, Hanover Park, IL 60133 120 Walnut Ave #1, Arlington Heights, IL 60005 570 Alcoa Ln, Hoffman Estates, IL 60169 1570 Tahoe Circle Dr #20606, Wheeling, IL 60090 111 Center St #348A, Lake Geneva, WI 53147 300 Wrigley Dr, Lake Geneva, WI 53147 570 Alcoa Ln, Hoffman Estates, IL 60194 1006 Cumberland Ct, Vernon Hills, IL 60061 476 Torrey Pines Way, Vernon Hills, IL 60061 1211 Crabtree Dr, Arlington Heights, IL 60004 310 Happfield Dr, Arlington Heights, IL 60004 437 Walnut Ave, Des Plaines, IL 60016 6230 Kenmore Ave, Chicago, IL 60660 |
| [email protected] | |
| Associated Business | 25 N Gifford Partnership Baby Sleeping Inc G Canyon Partners Nbs Recovery Inc Vera Clara, Inc Coolstandingscom, Inc Omega Electronics, Inc Newport Construction, Inc S P Graphics Corp Prompt Sales & Mailing Services, Inc Cmc Software Inc Streampay, Inc Hispanolink, Inc Ruh Custom Carpentry, Inc |
| Name / Names | Gary Allen Newland |
|---|---|
| Age | 54 |
| Birth Date | 1970 |
| Also Known As | Mary Koster |
| Person | 4085 Watson Rd, Marlette, MI 48453 |
| Phone Number | 989-635-3464 |
| Possible Relatives | Kerri Sue Newland |
| Previous Address |
6695 Ellsworth St, Marlette, MI 48453 79 RR 2 #79, Brimley, MI 49715 3024 77th St, Milwaukee, WI 53222 79 PO Box, Brimley, MI 49715 |
| Name / Names | Gary Melvin Newland |
|---|---|
| Age | 60 |
| Birth Date | 1964 |
| Also Known As | Gary N Newland |
| Person | 11305 Forest Gleam, Live Oak, TX 78233 |
| Phone Number | 210-653-4557 |
| Possible Relatives |
Ruth B Newlandbedruz Lakisha Lashawn New Melvin M Newland Ethel Wilmoth Newland Shari J Newland Kamilah Newland Ruth Newland |
| Previous Address |
2839 Woodbury Dr, San Antonio, TX 78217 8114 Setting Moon, San Antonio, TX 78255 2301 Quail Trl, Brownsville, TX 78520 10014 Broadway St #806, San Antonio, TX 78217 |
| [email protected] | |
| Associated Business | Northeast Christian Church |
| Name / Names | Gary Richard Newland |
|---|---|
| Age | 69 |
| Birth Date | 1955 |
| Person | 8144 Mellowwood Dr, Jenison, MI 49428 |
| Phone Number | 616-243-1222 |
| Possible Relatives |
Deborah Fern Newland Kathleen S Parsons Nicole Marie Newland |
| Previous Address |
8579 8 Mile Rd #8, Kaleva, MI 49645 136 Reniger Ct #120, East Lansing, MI 48823 137 Durand St, East Lansing, MI 48823 180 Harrison St, Manistee, MI 49660 628 Akers Hall, East Lansing, MI 48825 1333 Jane Ellen, Lowell, MI 49331 1375 Vineland Ct, Grand Rapids, MI 49508 |
| [email protected] |
| Name / Names | Gary D Newland |
|---|---|
| Age | 69 |
| Birth Date | 1955 |
| Person | Rr15, Johnson City, TN 37615 |
| Name / Names | Gary D Newland |
|---|---|
| Age | 74 |
| Birth Date | 1950 |
| Also Known As | G Newland |
| Person | 136 Liberty St, Rapid City, SD 57701 |
| Phone Number | 605-721-6006 |
| Possible Relatives |
Stacey L Newlande Joan R Newland Shawn Michael Newland |
| Previous Address | 1788 Indiana St #B, Grand Forks Afb, ND 58204 |
| Name / Names | Gary Edward Newland |
|---|---|
| Age | 76 |
| Birth Date | 1948 |
| Also Known As | Garry E Newland |
| Person | 532 11th St, Denison, IA 51442 |
| Phone Number | 712-263-6591 |
| Possible Relatives |
Linda Kathleen Newland Janelle A Newlandmorris |
| Previous Address |
1356 5th Ave, Manilla, IA 51454 1532 11th St, Denison, IA 51442 532 N Ave, Denison, IA 51442 352 11th St, Denison, IA 51442 901 3rd Ave #42, Denison, IA 51442 |
| Name / Names | Gary F Newland |
|---|---|
| Age | 76 |
| Birth Date | 1948 |
| Person | 60 Truman Ave, Salt Lake City, UT 84115 |
| Phone Number | 801-561-2877 |
| Possible Relatives |
Nancy M Newland Tammy Mcquiston Lester Nancy Newland |
| Previous Address |
2810 7268, West Jordan, UT 84084 60 Truman Ave, S Salt Lake, UT 84115 624 Spring Hill Dr, Salt Lake City, UT 84107 |
| Name / Names | Gary Lee Newland |
|---|---|
| Age | 77 |
| Birth Date | 1947 |
| Person | 440 Richard Way, Jacksonville, OR 97530 |
| Phone Number | 541-899-0110 |
| Possible Relatives |
Diana Lynne Newland Eric John Newland Eric W Bergland Gregory Cole Newland Diane Newland Doris E Newland Sjolund Lynn Newland M L Newland Nilson Larry Newland |
| Previous Address |
6740 Hyatt Lake Rd, Ashland, OR 97520 2825 Barnett Rd, Medford, OR 97504 4235 PO Box, Medford, OR 97501 6740 Hyatt Lake Rd, Ashland, OR 224 Kensington Sq, Medford, OR 97504 101 Kensington Sq, Medford, OR 97504 |
| Associated Business | Vista Pathology, Pc |
| Name / Names | Gary Kent Newland |
|---|---|
| Age | 77 |
| Birth Date | 1947 |
| Person | 3721 Emile Zola Ave, Phoenix, AZ 85032 |
| Phone Number | 630-961-3572 |
| Possible Relatives |
Alice Hildegard Newland Ryan K Newland |
| Previous Address |
4720 Oraibi Dr, Glendale, AZ 85308 1594 Derby Ct, Naperville, IL 60563 5701 Danbury Rd, Scottsdale, AZ 85254 4722 Bell Rd #1049, Phoenix, AZ 85032 201 Lexington Ave, Phoenix, AZ 85012 3720 Emile Zola Ave, Phoenix, AZ 85032 4720 Davis Rd, Glendale, AZ 85306 1825 Los Encinos Ave, Glendale, CA 91208 9831 Sunglow St, Pico Rivera, CA 90660 1027 Churchill Dr, Naperville, IL 60563 |
| Name / Names | Gary D Newland |
|---|---|
| Age | N/A |
| Person | 148 ROSEWOOD LN, JOHNSON CITY, TN 37615 |
| Phone Number | 423-477-9589 |
| Name / Names | Gary M Newland |
|---|---|
| Age | N/A |
| Person | 8114 SETTING MOON, SAN ANTONIO, TX 78255 |
| Phone Number | 210-653-4557 |
| Name / Names | Gary R Newland |
|---|---|
| Age | N/A |
| Person | 8144 MELLOWWOOD DR, JENISON, MI 49428 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 39 SAGER RD, VALPARAISO, IN 46383 |
| Phone Number | 219-465-1710 |
| Name / Names | Gary F Newland |
|---|---|
| Age | N/A |
| Person | 4945 Viewmont, Salt Lake City, UT 84117 |
| Previous Address |
740 1700,Salt Lake City, UT 84104 455 300,Salt Lake City, UT 84111 4945 Diewmont,Salt Lake City, UT 84117 |
| Associated Business | CENTRAL VALLEY TRANSMISSION PARTS LLC CENTRAL VALLEY TRANSMISSION PARTS, LLC |
| Name / Names | Gary A Newland |
|---|---|
| Age | N/A |
| Person | 121 Wilke, Arlington Hts, IL 60005 |
| Previous Address | 327 Andrew,Schaumburg, IL 60193 |
| Associated Business | RUH CUSTOM CARPENTRY INC |
| Name / Names | Gary A Newland |
|---|---|
| Age | N/A |
| Person | 120 S WALNUT AVE, ARLINGTON HEIGHTS, IL 60005 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 125 PYRAMID PINES EST, SARATOGA SPRINGS, NY 12866 |
| Name / Names | Gary L Newland |
|---|---|
| Age | N/A |
| Person | 440 RICHARD WAY, JACKSONVILLE, OR 97530 |
| Phone Number | 541-899-0110 |
| Name / Names | Gary E Newland |
|---|---|
| Age | N/A |
| Person | 532 N 11TH ST, DENISON, IA 51442 |
| Phone Number | 712-263-6591 |
| Name / Names | Gary A Newland |
|---|---|
| Age | N/A |
| Person | 4085 WATSON RD, MARLETTE, MI 48453 |
| Phone Number | 989-635-3464 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 330 Philadelphia, Rapid City, SD 57701 |
| Possible Relatives | Alvah A Newland |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 148 Rosewood, Gray, TN 37615 |
| Possible Relatives | Norma Jean Beaudoin |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 740 W 1700 S, STE 10 SALT LAKE CITY, UT 84104 |
| Name / Names | Gary J Newland |
|---|---|
| Age | N/A |
| Person | RR 2, BOX 250 MEDFORD, OK 73759 |
| Name / Names | Gary L Newland |
|---|---|
| Age | N/A |
| Person | 233 E NORTH ST, TEKONSHA, MI 49092 |
| Name / Names | Gary A Newland |
|---|---|
| Age | N/A |
| Person | 440 James, Cary, IL 60013 |
| Name / Names | Gary L Newland |
|---|---|
| Age | N/A |
| Person | 128 PO Box, Medford, OR 97501 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 4459 Foxton, Dayton, OH 45414 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 415 Main, Algonquin, IL 60102 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 113 PO Box, Eustace, TX 75124 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 1630 Cambria, Algonquin, IL 60102 |
| Associated Business | FORESTVIEW PARTNERSHIP |
| Name / Names | Gary L Newland |
|---|---|
| Age | N/A |
| Person | 1746 PO Box, Medford, OR 97501 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 22 Webster, Schaumburg, IL 60193 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 285 Hawthorn, Hoffman Estates, IL 60195 |
| Name / Names | Gary A Newland |
|---|---|
| Age | N/A |
| Person | 105 Crystal Lake, Crystal Lake, IL 60014 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 77 Evergreen, Arlington Heights, IL 60005 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 309 W NORTH ST, TEKONSHA, MI 49092 |
| Phone Number | 517-583-0927 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 309 E NORTH ST, TEKONSHA, MI 49092 |
| Phone Number | 517-583-0927 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 121 S WILKE RD, STE 101 ARLINGTON HEIGHTS, IL 60005 |
| Phone Number | 847-797-8000 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 6 Ravenna, Asheville, NC 28803 |
| Name / Names | Gary Newland |
|---|---|
| Age | N/A |
| Person | 4945 VIEWMONT ST, SALT LAKE CITY, UT 84117 |
| Business Name | Oen Automatic Transm Parts |
|---|---|
| Person Name | Gary Newland |
| Position | company contact |
| State | UT |
| Address | 60 W Truman Ave Salt Lake City UT 84115-2617 |
| Industry | Wholesale Trade - Durable Goods (Products) |
| SIC Code | 5013 |
| SIC Description | Motor Vehicle Supplies And New Parts |
| Phone Number | 801-487-1639 |
| Business Name | OEM Automatic Transmission |
|---|---|
| Person Name | Gary Newland |
| Position | company contact |
| State | UT |
| Address | 60 W Truman Ave Salt Lake City UT 84115-2617 |
| Industry | Automotive Services, Parking and Repair (Automotive) |
| SIC Code | 7537 |
| SIC Description | Automotive Transmission Repair Shops |
| Phone Number | 801-487-1639 |
| Number Of Employees | 2 |
| Annual Revenue | 222480 |
| Business Name | Northeast Christian Church |
|---|---|
| Person Name | Gary Newland |
| Position | company contact |
| State | TX |
| Address | 2839 Woodbury Dr San Antonio TX 78217-5736 |
| Industry | Membership Organizations (Organizations) |
| SIC Code | 8661 |
| SIC Description | Religious Organizations |
| Phone Number | 210-828-5034 |
| Person Name | Gary Newland |
|---|---|
| Filing Number | 0020622601 |
| Position | Chairman |
| State | TX |
| Address | 8114 Setting Moon, San Antonio TX 78247 |
| Person Name | Gary Newland |
|---|---|
| Filing Number | 0020622601 |
| Position | Director |
| State | TX |
| Address | 8114 Setting Moon, San Antonio TX 78255 |
| Name | Gary M Newland |
|---|---|
| Address | 8114 Setting Moon San Antonio TX 78255 -3306 |
| Phone Number | 210-653-4557 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1961-08-04 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $75,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 3 |
| Range Of New Credit | 1001 |
| Education | Completed College |
| Language | English |
| Name | Gary Newland |
|---|---|
| Address | 39 Sager Rd Valparaiso IN 46383 -7827 |
| Phone Number | 219-465-1710 |
| [email protected] | |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $200,000 |
| Estimated Net Worth | $250,000 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed Graduate School |
| Language | English |
| Name | Gary D Newland |
|---|---|
| Address | 148 Rosewood Ln Johnson City TN 37615 -2932 |
| Phone Number | 423-477-9589 |
| Gender | Male |
| Date Of Birth | 1952-06-26 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $100,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 501 |
| Education | Completed High School |
| Language | English |
| Name | Gary Newland |
|---|---|
| Address | 429 W Randall St Tekonsha MI 49092-9571 -9571 |
| Phone Number | 517-583-1016 |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $10,000 |
| Estimated Net Worth | $10,000 |
| Range Of New Credit | 1001 |
| Education | Completed College |
| Language | English |
| Name | Gary R Newland |
|---|---|
| Address | 125 Pyramid Pines Est Saratoga Springs NY 12866 -9433 |
| Phone Number | 518-306-4155 |
| Mobile Phone | 518-306-4155 |
| [email protected] | |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $45,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 2 |
| Range Of New Credit | 1001 |
| Education | Completed College |
| Language | English |
| Name | Gary L Newland |
|---|---|
| Address | 440 Richard Way Jacksonville OR 97530 -9703 |
| Phone Number | 541-899-0110 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1944-01-04 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $150,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed College |
| Language | English |
| Name | Gary D Newland |
|---|---|
| Address | 136 E Liberty St Rapid City SD 57701 -7673 |
| Phone Number | 605-721-6006 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1946-01-01 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $150,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 2 |
| Range Of New Credit | 5001 |
| Education | Completed High School |
| Language | English |
| Name | Gary R Newland |
|---|---|
| Address | 8144 Mellowwood Dr Jenison MI 49428 -8528 |
| Phone Number | 616-457-0836 |
| Gender | Male |
| Date Of Birth | 1952-03-13 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $200,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 6 |
| Range Of New Credit | 1001 |
| Education | Completed College |
| Language | English |
| Name | Gary E Newland |
|---|---|
| Address | 532 N 11th St Denison IA 51442 -1354 |
| Phone Number | 712-263-6591 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1945-03-19 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $60,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 5 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed College |
| Language | English |
| Name | Gary A Newland |
|---|---|
| Address | 120 S Walnut Ave Arlington Heights IL 60005 APT 1-1726 |
| Phone Number | 847-259-6792 |
| [email protected] | |
| Gender | Male |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $175,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | Greater than $9,999 |
| Education | Completed Graduate School |
| Language | English |
| Name | Gary A Newland |
|---|---|
| Address | 4085 Watson Rd Marlette MI 48453 -9300 |
| Phone Number | 989-635-3464 |
| Mobile Phone | 989-615-6734 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1967-04-09 |
| Ethnicity | English |
| Ethnic Group | Western European |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $25,000 |
| Lines Of Credit Trade Counter | 4 |
| Range Of New Credit | 0 |
| Language | English |
| Name | NEWLAND, GARY L DR |
|---|---|
| Amount | 250.00 |
| To | College of American Pathologists |
| Year | 2006 |
| Transaction Type | 15 |
| Filing ID | 25990514560 |
| Application Date | 2005-03-18 |
| Contributor Occupation | PATHOLOGIST |
| Contributor Employer | MEDFORD PATHOLOGISTS |
| Contributor Gender | M |
| Committee Name | College of American Pathologists |
| Name | NEWLAND, GARY |
|---|---|
| Amount | 250.00 |
| To | Barack Obama (D) |
| Year | 2008 |
| Transaction Type | 15 |
| Filing ID | 28993005269 |
| Application Date | 2008-10-14 |
| Contributor Occupation | Pathelogist |
| Contributor Employer | Vista Pathology Pc |
| Organization Name | Vista Pathology Pc |
| Contributor Gender | M |
| Recipient Party | D |
| Committee Name | Obama for America |
| Seat | federal:president |
| Address | 440 Richard Way JACKSONVILLE OR |
| Name | NEWLAND, GARY L DR |
|---|---|
| Amount | 200.00 |
| To | College of American Pathologists |
| Year | 2006 |
| Transaction Type | 15 |
| Filing ID | 26990167928 |
| Application Date | 2005-12-29 |
| Contributor Occupation | PATHOLOGIST |
| Contributor Employer | MEDFORD PATHOLOGISTS |
| Contributor Gender | M |
| Committee Name | College of American Pathologists |
| Name | GARY NEWLAND |
|---|---|
| Car | JEEP WRANGLER |
| Year | 2012 |
| Address | PO Box 114, Tekonsha, MI 49092-0114 |
| Vin | 1C4AJWAG2CL158925 |
| Phone | 269-420-7101 |
| Name | GARY NEWLAND |
|---|---|
| Car | VOLKSWAGEN PASSAT |
| Year | 2012 |
| Address | 148 Rosewood Ln, Johnson City, TN 37615-2932 |
| Vin | 1VWCN7A34CC055065 |
| Phone | 423-477-9899 |
| Name | GARY NEWLAND |
|---|---|
| Car | GMC SIERRA 1500 |
| Year | 2011 |
| Address | 102151 Johnston Rd, Medford, OK 73759-5056 |
| Vin | 3GTP2VE39BG213228 |
| Phone | 580-849-6945 |
| Name | GARY NEWLAND |
|---|---|
| Car | FORD FUSION |
| Year | 2010 |
| Address | 8144 MELLOWWOOD DR, JENISON, MI 49428 |
| Vin | 3FAHP0HA8AR331878 |
| Phone | 616-457-0836 |
| Name | GARY NEWLAND |
|---|---|
| Car | ACURA RL |
| Year | 2010 |
| Address | 440 RICHARD WAY, JACKSONVILLE, OR 97530-9703 |
| Vin | JH4KB2F63AC000597 |
| Name | GARY NEWLAND |
|---|---|
| Car | CHEVROLET COBALT |
| Year | 2008 |
| Address | 4085 Watson Rd, Marlette, MI 48453-9300 |
| Vin | 1G1AL58F987121235 |
| Phone | 989-635-3464 |
| Name | GARY NEWLAND |
|---|---|
| Car | BUICK LACROSSE |
| Year | 2007 |
| Address | 136 E Liberty St, Rapid City, SD 57701-7673 |
| Vin | 2G4WC582871216872 |
| Phone | 605-721-6006 |
| Name | Gary Newland |
|---|---|
| Car | CHEVROLET SILVERADO 1500 |
| Year | 2007 |
| Address | 532 N 11th St, Denison, IA 51442-1354 |
| Vin | 1GCEK14057Z607226 |
| Phone | 712-263-6591 |
| Name | Gary Newland |
|---|---|
| Domain | drumcamp.org |
| Contact Email | [email protected] |
| Create Date | 2003-10-01 |
| Update Date | 2012-10-02 |
| Registrar Name | Melbourne IT, Ltd (R52-LROR) |
| Registrant Address | 21 Oakfield Road Aylsham Norfolk nr11 6al |
| Registrant Country | UNITED KINGDOM |
| Registrant Fax | 4401263735097 |
| Name | gary newland |
|---|---|
| Domain | defense-attorney-workers-compensation-employer-uninsured.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-11-07 |
| Update Date | 2013-10-16 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 121 S. Wilke Rd #101 Arligton Heights Illinois 60005 |
| Registrant Country | UNITED STATES |
| Name | gary newland |
|---|---|
| Domain | cook-county-bankruptcy-foreclosure-defense-lawyer.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-10-22 |
| Update Date | 2013-10-16 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 121 S. Wilke Rd #101 Arligton Heights Illinois 60005 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 847 7979090 |
| Name | gary newland |
|---|---|
| Domain | lake-county-work-comp-lawyer-personal-injury-attorney.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-10-22 |
| Update Date | 2013-10-23 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
| Registrant Country | UNITED STATES |
| Name | gary newland |
|---|---|
| Domain | lake-county-bankruptcy-foreclosure-defense-lawyer.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-10-22 |
| Update Date | 2013-10-23 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
| Registrant Country | UNITED STATES |
| Name | gary newland |
|---|---|
| Domain | derechosdeimmigrantes.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2013-10-16 |
| Update Date | 2013-10-16 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 121 S. Wilke Rd #101 Arligton Heights Illinois 60005 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 8477979090 |
| Name | gary newland |
|---|---|
| Domain | newlandlawimmigrationvisalawfirm.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-11-27 |
| Update Date | 2013-01-22 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 121 S. Wilke Rd #101 Arligton Heights Illinois 60005 |
| Registrant Country | UNITED STATES |
| Name | gary newland |
|---|---|
| Domain | newlandlawdefectivemedicalproducts.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-11-27 |
| Update Date | 2013-01-16 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 121 S. Wilke Rd #101 Arligton Heights Illinois 60005 |
| Registrant Country | UNITED STATES |
| Name | gary newland |
|---|---|
| Domain | newlandlawrsdcrpsnervelawfirm.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-11-27 |
| Update Date | 2013-01-22 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 121 S. Wilke Rd #101 Arligton Heights Illinois 60005 |
| Registrant Country | UNITED STATES |
| Name | gary newland |
|---|---|
| Domain | newlandlawbankruptcyforeclosureloanmodification.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-11-27 |
| Update Date | 2013-02-11 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 121 S. Wilke Rd #101 Arligton Heights Illinois 60005 |
| Registrant Country | UNITED STATES |
| Name | Gary Newland |
|---|---|
| Domain | neccsa.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2005-02-25 |
| Update Date | 2013-02-26 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 2839 Woodbury San Antonio TX 78217 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 12108285034 |
| Name | gary newland |
|---|---|
| Domain | dupage-county-bankruptcy-foreclosure-defense-lawyer.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-10-22 |
| Update Date | 2013-10-23 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
| Registrant Country | UNITED STATES |
| Name | gary newland |
|---|---|
| Domain | mchenry-county-bankruptcy-foreclosure-defense-lawyer.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2010-10-22 |
| Update Date | 2013-10-23 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
| Registrant Country | UNITED STATES |
| Name | gary newland |
|---|---|
| Domain | medicalproductliabilitymedicationjournal.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2012-11-27 |
| Update Date | 2012-12-10 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 121 S. Wilke Rd #101 Arligton Heights Illinois 60005 |
| Registrant Country | UNITED STATES |