We have found 99 public records related to Andrew Newby in 17 states . Ethnicity of all people found is English. Education level of all people found is Completed College. All people found speak English language. There are 3 business registration records connected with Andrew Newby in public records. The businesses are registered in 2 states: OK and GA. All found businesses are engaged in Agricultural Production - Crops (Agriculture) industry. There are 18 profiles of government employees in our database. Job titles of people found are: Network Support Analyst, Network Administrator, Noninst Prog Director, Assistant County Attorney and Police Officer. These employees work in 5 states: TX, AL, OK, VA and CA. Average wage of employees is $81,085.
Name / Names | Andrew Newby |
---|---|
Age | 31 |
Birth Date | 1993 |
Person | 1850 18th, Ocala, FL 34471 |
Possible Relatives |
Lana P Newby Donovan C Newby Lana P Newby |
Previous Address | 4091 22nd,Ocala, FL 34480 |
Available |
Name / Names | Andrew D Newby |
---|---|
Age | 31 |
Birth Date | 1993 |
Person | 400 Putnam, Tallahassee, FL 32301 |
Name / Names | Andrew S Newby |
---|---|
Age | 34 |
Birth Date | 1990 |
Person | 105 Stratford, Port Orange, FL 32127 |
Possible Relatives |
Scott S Newby Deanna Mary Newby Joshua S Newby Ralph S Newby |
Name / Names | Andrew K Newby |
---|---|
Age | 35 |
Birth Date | 1989 |
Person | 108 Wareham Lake Shore, East Wareham, MA 02538 |
Possible Relatives |
Jean M Newby Kenneth P Newby Erica L Newby |
Previous Address | 40 Maura,Bridgewater, MA 02324 |
Name / Names | Andrew Newby |
---|---|
Age | 39 |
Birth Date | 1985 |
Person | 5405 32nd, Arlington, VA 22207 |
Possible Relatives |
Carl R Newby Deborah M Newby Matthew Christopher Newby Paul R Newby |
Name / Names | Andrew M Newby |
---|---|
Age | 41 |
Birth Date | 1983 |
Person | 8610 Easement, Riverview, FL 33578 |
Possible Relatives | Mark Andrew Newby |
Name / Names | Andrew L Newby |
---|---|
Age | 46 |
Birth Date | 1978 |
Person | 000212 Glen Mawr, Golden, CO 80403 |
Possible Relatives | Sarah Lynn Newby |
Name / Names | Andrew C Newby |
---|---|
Age | 47 |
Birth Date | 1977 |
Person | 2039 Pautucket Rd, Toledo, OH 43615 |
Possible Relatives |
Kimberly M Newby Emily Ann Hesselbein Michele G Larger |
Previous Address |
2144 Robinwood Ave #1, Toledo, OH 43620 002144 Robinwood Ave, Toledo, OH 43620 828 Chestnut Ave, Sidney, OH 45365 644 Fountain Ave, Springfield, OH 45504 644 Fulton, Springfield, OH 45505 1320 Parkside Blvd, Toledo, OH 43607 1308 Roosevelt Ave, Toledo, OH 43607 644 Felton, Springfield, OH 45505 |
Name / Names | Andrew R Newby |
---|---|
Age | 48 |
Birth Date | 1976 |
Person | 3990 Neff St, Rapid City, SD 57703 |
Possible Relatives |
Shannon M Everett April Lynne Newby |
Previous Address |
9211 Harry St #610, Wichita, KS 67207 8926 Bluestem St, Wichita, KS 67207 7677 21st St #2102, Wichita, KS 67206 4200 Highway 44 #11, Rapid City, SD 57703 5425 Washington St, Wichita, KS 67216 128 3rd St, Cheney, WA 99004 4141 Seneca St #1215, Wichita, KS 67217 8800 Harry St #309, Wichita, KS 67207 709 Minnesota St #202, Rapid City, SD 57701 1017 Elm St #19, Cheney, WA 99004 4148 Hydraulic St #44, Wichita, KS 67216 3327 Rapid St, Rapid City, SD 57702 3327 1st #2, Rapid City, SD 57702 |
Name / Names | Andrew L Newby |
---|---|
Age | 49 |
Birth Date | 1975 |
Person | 1624 Douglas St, Sioux City, IA 51105 |
Phone Number | 712-202-0000 |
Possible Relatives |
Kevin L Newby Trina Lynteague Anthony R Newby Christian Patricia Newby Mark M Newby Michelle J Newby Phillip Newby Elizabeth Newbyv Brittany C Newby |
Previous Address |
1624 Douglas St #1, Sioux City, IA 51105 4525 Talbot Rd, Sioux City, IA 51103 1624 Douglas St #2, Sioux City, IA 51105 2011 Virginia St, Sioux City, IA 51104 2118 Magnolia St, Sioux City, IA 51106 3027 Summit St, Sioux City, IA 51104 510 16th St, Sioux City, IA 51105 12011 Virginia St, Sioux City, IA 51104 424 17th St, Sioux City, IA 51105 811 Bruner Ave, Sioux City, IA 51109 4214 Van Buren St, Sioux City, IA 51108 1505 35th St, Sioux City, IA 51104 |
Name / Names | Andrew Lee Newby |
---|---|
Age | 49 |
Birth Date | 1975 |
Person | 4847 Cedardale Rd #R5, Woodward, OK 73801 |
Possible Relatives |
Dawnel Loree Newby Dawnal L Ward |
Previous Address |
4100 Hanks Trl #C, Woodward, OK 73801 18 Restmore Ranchettes, Woodward, OK 73801 3319 Edgewater Dr, Woodward, OK 73801 1 PO Box, Woodward, OK 73802 2426 Webster Ave #2, Woodward, OK 73801 2426 Webster Ave #4, Woodward, OK 73801 3311 22nd St #191, Woodward, OK 73801 1951 PO Box, Woodward, OK 73802 84 PO Box, Lindsay, OK 73052 |
Name / Names | Andrew D Newby |
---|---|
Age | 50 |
Birth Date | 1974 |
Also Known As | Amy D Bledsue |
Person | 1217 Hemphill Dr, Cleburne, TX 76033 |
Phone Number | 817-294-2833 |
Possible Relatives |
Denica Jean Newby Andrew Douglas Newby Richard Terry Bledsue Carolyn Benton Bledsue Timothy Wayne Sloan Bettye Hall Newby Jerry D Newby Michael S Bledsue Dennis E Bledsue |
Previous Address |
6422 Landview Dr, Fort Worth, TX 76133 7928 Woodland Dr, North Richland Hills, TX 76180 2501 42nd St, Waco, TX 76710 475 RR 7 #475, Cleburne, TX 76031 6824 Edmond Ave, Waco, TX 76710 475 PO Box, Cleburne, TX 76033 |
[email protected] |
Name / Names | Andrew Douglas Newby |
---|---|
Age | 55 |
Birth Date | 1969 |
Also Known As | Andy Newby |
Person | 1311 Glenhaven Dr #CBS10, Cleburne, TX 76033 |
Phone Number | 817-645-0874 |
Possible Relatives |
Denica Jean Newby Andrew D Newby Bettye Hall Newby |
Previous Address |
114 Glen Rose Ave, Cleburne, TX 76033 1217 Hemphill Dr, Cleburne, TX 76033 4071 RR 4 POB, Alvarado, TX 76009 RR 4OX, Alvarado, TX 76009 |
[email protected] |
Name / Names | Andrew D Newby |
---|---|
Age | 60 |
Birth Date | 1964 |
Person | 15 Avenue A, Melbourne, FL 32901 |
Possible Relatives |
Carolyn C Newby Kristine S Armstrong Kathleen A Cottee Brian D Newby Amber Joy Newby Misty Dawn Newby Harold Dean Newby Samantha Sue Newby Michael Dean Newby |
Previous Address |
198 Magnolia,Melbourne, FL 32935 15 East,Melbourne, FL 32904 15 Avae A,Melbourne, FL 32901 |
Available |
Name / Names | Andrew Newby |
---|---|
Age | 85 |
Birth Date | 1938 |
Person | 1865 PO Box, Sanford, NC 27331 |
Available |
Name / Names | Andrew L Newby |
---|---|
Age | 87 |
Birth Date | 1936 |
Person | Route 618, Dendron, VA 23839 |
Name / Names | Andrew Davis Newby |
---|---|
Age | 110 |
Birth Date | 1914 |
Person | 1341 Paradise Rd #144B, Edenton, NC 27932 |
Possible Relatives |
Agnes Claudia Newby Clara Sawyer Newby |
Previous Address |
338 Drummonds Point Rd, Edenton, NC 27932 566 PO Box, Edenton, NC 27932 120 RR 2, Edenton, NC 27932 1020 RR 2, Edenton, NC 27932 64 RR 2 HWY #20266, Edenton, NC 27932 RR 2, Edenton, NC 27932 1020 PO Box, Edenton, NC 27932 23090 Avenue D, Alva, FL 33920 120 PO Box, Edenton, NC 27932 |
Name / Names | Andrew D Newby |
---|---|
Age | N/A |
Person | 1311 GLENHAVEN DR, CLEBURNE, TX 76033 |
Name / Names | Andrew Newby |
---|---|
Age | N/A |
Person | 1351 COUNTY ROAD 621, RIPLEY, MS 38663 |
Name / Names | Andrew Newby |
---|---|
Age | N/A |
Person | 109 15TH ST, SIOUX CITY, IA 51103 |
Name / Names | Andrew Newby |
---|---|
Age | N/A |
Person | 904 Goldendale, Greenville, SC 29607 |
Name / Names | Andrew L Newby |
---|---|
Age | N/A |
Person | 28361 DOGWOOD LN, WAVERLY, VA 23890 |
Phone Number | 804-834-2188 |
Name / Names | Andrew C Newby |
---|---|
Age | N/A |
Person | 1301 Summit, Toledo, OH 43604 |
Associated Business | AVATAR, LLC |
Name / Names | Andrew S Newby |
---|---|
Age | N/A |
Person | 105 STRATFORD SQ, PORT ORANGE, FL 32127 |
Phone Number | 386-788-7985 |
Name / Names | Andrew L Newby |
---|---|
Age | N/A |
Person | 4100 W HANKS TRL, UNIT C WOODWARD, OK 73801 |
Phone Number | 580-256-0808 |
Name / Names | Andrew Newby |
---|---|
Age | N/A |
Person | 1819 DUNBAR PL, BURLINGTON, NC 27215 |
Phone Number | 336-586-7002 |
Name / Names | Andrew K Newby |
---|---|
Age | N/A |
Person | 108 WAREHAM LAKE SHORE DR, EAST WAREHAM, MA 2538 |
Phone Number | 508-295-1842 |
Name / Names | Andrew L Newby |
---|---|
Age | N/A |
Person | 212 GLEN MAWR DR, GOLDEN, CO 80403 |
Phone Number | 303-258-8220 |
Name / Names | Andrew L Newby |
---|---|
Age | N/A |
Person | 212 GLEN MAWR DR, BLACK HAWK, CO 80422 |
Phone Number | 303-258-8220 |
Name / Names | Andrew Newby |
---|---|
Age | N/A |
Person | 408 Mount Vernon, Vineland, NJ 08360 |
Associated Business | SAAB-SERVICE ABOVE AND BEYOND INC |
Name / Names | Andrew Newby |
---|---|
Age | N/A |
Person | 4621 County Road 2230, Caddo Mills, TX 75135 |
Possible Relatives |
Andyamy Newby Richie Andrew Newby Amy Robbins Newby Amber Newby Ricky Newby Burton Newby |
Name / Names | Andrew Newby |
---|---|
Age | N/A |
Person | 109 15th, Sioux City, IA 51103 |
Possible Relatives | Elizabeth Newbyv |
Available |
Name / Names | Andrew Newby |
---|---|
Age | N/A |
Person | 4621 COUNTY ROAD 2230, CADDO MILLS, TX 75135 |
Business Name | NAIBUN TRADING INTERNATIONAL LLC |
---|---|
Person Name | Andrew Newby |
Position | registered agent |
State | GA |
Address | 2980 PACIFIC DRIVE C, Norcross, GA 30071 |
Business Contact Type | Organizer |
Model Type | LLC |
Locale | Domestic |
Qualifier | None |
Effective Date | 2013-04-24 |
Entity Status | Active/Owes Current Year AR |
Type | Organizer |
Business Name | NAIBUN MOTORS LLC |
---|---|
Person Name | ANDREW NEWBY |
Position | registered agent |
State | GA |
Address | 2980C PACIFIC DRIVE, NORCROSS, GA 30071 |
Business Contact Type | Organizer |
Model Type | LLC |
Locale | Domestic |
Qualifier | None |
Effective Date | 2013-05-29 |
Entity Status | Active/Noncompliance |
Type | Organizer |
Business Name | Andrew Newby |
---|---|
Person Name | Andrew Newby |
Position | company contact |
State | OK |
Address | RURAL ROUTE 2 BOX 94 Walters OK 73572-9631 |
Industry | Agricultural Production - Crops (Agriculture) |
SIC Code | 139 |
SIC Description | Field Crops, Except Cash Grain |
Phone Number | 580-875-2725 |
State | CA |
---|---|
Calendar Year | 2017 |
Employer | Sacramento |
Job Title | Police Officer |
Name | Andrew J Newby |
Annual Wage | $131,775 |
Base Pay | $88,680 |
Overtime Pay | N/A |
Other Pay | $5,250 |
Benefits | $37,845 |
Total Pay | $93,930 |
Status | FT |
State | OK |
---|---|
Calendar Year | 2015 |
Employer | District Wide Services |
Job Title | Noninst Prog Director |
Name | Newby Andrew |
Annual Wage | $63,113 |
State | OK |
---|---|
Calendar Year | 2016 |
Employer | District Wide Services |
Job Title | Noninst Prog Director |
Name | Newby Andrew |
Annual Wage | $63,900 |
State | OK |
---|---|
Calendar Year | 2017 |
Employer | District Wide Services |
Job Title | Noninst Prog Director |
Name | Newby Andrew |
Annual Wage | $64,688 |
State | OK |
---|---|
Calendar Year | 2018 |
Employer | District Wide Services |
Job Title | Noninst Prog Director |
Name | Newby Andrew |
Annual Wage | $65,475 |
State | TX |
---|---|
Calendar Year | 2017 |
Employer | City Of Cleburne |
Job Title | Network Support Analyst |
Name | Newby Andrew D |
Annual Wage | $42,479 |
State | TX |
---|---|
Calendar Year | 2018 |
Employer | City Of West University Place |
Job Title | Network Administrator |
Name | Newby Andrew D |
Annual Wage | $79,329 |
State | VA |
---|---|
Calendar Year | 2015 |
Employer | County Of Henrico |
Job Title | Assistant County Attorney Ii |
Name | Newby Andrew Ramsey |
Annual Wage | $74,247 |
State | AL |
---|---|
Calendar Year | 2017 |
Employer | University of Auburn |
Name | Newby Andrew |
Annual Wage | $4,241 |
State | VA |
---|---|
Calendar Year | 2016 |
Employer | County Of Henrico |
Job Title | Assistant County Attorney Ii |
Name | Newby Andrew Ramsey |
Annual Wage | $75,732 |
State | VA |
---|---|
Calendar Year | 2018 |
Employer | County of Henrico |
Job Title | Assistant County Attorney Iii |
Name | Newby Andrew Ramsey |
Annual Wage | $85,256 |
State | CA |
---|---|
Calendar Year | 2012 |
Employer | Sacramento |
Job Title | Police Officer |
Name | Andrew Newby J |
Annual Wage | $123,539 |
Base Pay | $88,385 |
Overtime Pay | $2,350 |
Other Pay | $2,400 |
Benefits | $30,403 |
Total Pay | $93,136 |
State | CA |
---|---|
Calendar Year | 2013 |
Employer | Sacramento |
Job Title | Police Officer |
Name | Andrew Newby J |
Annual Wage | $128,326 |
Base Pay | $92,283 |
Overtime Pay | $1,673 |
Other Pay | $2,400 |
Benefits | $31,970 |
Total Pay | $96,355 |
Status | FT |
State | CA |
---|---|
Calendar Year | 2014 |
Employer | Sacramento |
Job Title | Police Officer |
Name | Andrew J Newby |
Annual Wage | $128,317 |
Base Pay | $91,689 |
Overtime Pay | $1,685 |
Other Pay | $2,400 |
Benefits | $32,543 |
Total Pay | $95,774 |
Status | FT |
State | CA |
---|---|
Calendar Year | 2015 |
Employer | Sacramento |
Job Title | Police Officer |
Name | Andrew J Newby |
Annual Wage | $114,548 |
Base Pay | $81,587 |
Overtime Pay | $124 |
Other Pay | $3,310 |
Benefits | $29,527 |
Total Pay | $85,021 |
Status | FT |
State | CA |
---|---|
Calendar Year | 2016 |
Employer | Sacramento |
Job Title | Police Officer |
Name | Andrew J Newby |
Annual Wage | $118,281 |
Base Pay | $81,678 |
Overtime Pay | N/A |
Other Pay | $3,310 |
Benefits | $33,293 |
Total Pay | $84,988 |
Status | FT |
State | VA |
---|---|
Calendar Year | 2017 |
Employer | County of Henrico |
Job Title | Assistant County Attorney Iii |
Name | Newby Andrew Ramsey |
Annual Wage | $85,256 |
State | AL |
---|---|
Calendar Year | 2016 |
Employer | University Of Auburn |
Name | Newby Andrew C |
Annual Wage | $11,012 |
Name | Andrew D Newby |
---|---|
Address | 926 Cortez Ct Loveland CO 80537 -4510 |
Telephone Number | 970-290-9014 |
Mobile Phone | 970-290-1486 |
[email protected] | |
Gender | Male |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $50,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 1 |
Education | Completed College |
Language | English |
Name | Andrew C Newby |
---|---|
Address | 137 Winding Creek Rd Nw Madison AL 35757 -6325 |
Phone Number | 256-945-7412 |
Gender | Male |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $75,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 2 |
Education | Completed College |
Language | English |
Name | Andrew Newby |
---|---|
Address | 105 Stratford Sq Port Orange FL 32127 -5938 |
Phone Number | 386-788-7985 |
Mobile Phone | 386-295-2534 |
[email protected] | |
Gender | Male |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $25,000 |
Education | Completed College |
Language | English |
Name | Andrew R Newby |
---|---|
Address | 3330 N Vernon St Arlington VA 22207 -4468 |
Phone Number | 703-241-0175 |
[email protected] | |
Gender | Male |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $100,000 |
Estimated Net Worth | $0 |
Lines Of Credit Trade Counter | 2 |
Education | Completed College |
Language | English |
Name | Andrew L Newby |
---|---|
Address | 212 Glen Mawr Dr Black Hawk CO 80422 -4354 |
Phone Number | 720-273-5430 |
Telephone Number | 720-201-7460 |
Mobile Phone | 720-201-7460 |
[email protected] | |
Gender | Male |
Date Of Birth | 1975-01-28 |
Ethnicity | English |
Ethnic Group | Western European |
Estimated Household Income | $15,000 |
Estimated Net Worth | $100,000 |
Lines Of Credit Trade Counter | 1 |
Education | Completed College |
Language | English |
Name | ANDREW DOUGLAS NEWBY & DENICA NEWBY |
---|---|
Address | 1311 Glenhaven Drive Cleburne TX 76033-6627 |
Value | 562 |
Name | ANDREW C NEWBY |
---|---|
Address | 2125 Scottwood Avenue Toledo OH |
Value | 8700 |
Landvalue | 8700 |
Buildingvalue | 58900 |
Bedrooms | 5 |
Numberofbedrooms | 5 |
Type | Residential |
Name | ANDREW NEWBY |
---|---|
Type | Democrat Voter |
State | CO |
Address | 926 CORTEZ CT, LOVELAND, CO 80537 |
Phone Number | 970-290-1486 |
Email Address | [email protected] |
Name | ANDREW NEWBY |
---|---|
Type | Democrat Voter |
State | CO |
Address | PO BOX 1301, NEDERLAND, CO 80466 |
Phone Number | 720-273-5430 |
Email Address | [email protected] |
Name | Andrew C Newby |
---|---|
Visit Date | 4/13/10 8:30 |
Appointment Number | U59933 |
Type Of Access | VA |
Appt Made | 3/6/14 0:00 |
Appt Start | 3/7/14 12:00 |
Appt End | 3/7/14 23:59 |
Total People | 9 |
Last Entry Date | 3/6/14 10:21 |
Meeting Location | OEOB |
Caller | ALLISON |
Release Date | 06/27/2014 07:00:00 AM +0000 |
Badge Number | 99988 |
Name | Andrew C Newby |
---|---|
Visit Date | 4/13/10 8:30 |
Appointment Number | U15829 |
Type Of Access | VA |
Appt Made | 8/15/2013 0:00 |
Appt Start | 8/15/2013 9:30 |
Appt End | 8/15/2013 23:59 |
Total People | 29 |
Last Entry Date | 8/15/2013 5:35 |
Meeting Location | OEOB |
Caller | KEVIN |
Release Date | 11/29/2013 08:00:00 AM +0000 |
Badge Number | 98063 |
Name | ANDREW F NEWBY |
---|---|
Visit Date | 4/13/10 8:30 |
Appointment Number | U61945 |
Type Of Access | VA |
Appt Made | 12/7/09 9:38 |
Appt Start | 12/9/09 11:00 |
Appt End | 12/9/09 23:59 |
Total People | 239 |
Last Entry Date | 12/7/09 9:38 |
Meeting Location | WH |
Caller | VISITORS |
Description | 11.30AM GROUP TOURS |
Release Date | 03/26/2010 07:00:00 AM +0000 |
Name | ANDREW NEWBY |
---|---|
Car | DODGE CHALLENGER |
Year | 2012 |
Address | 2125 Scottwood Ave, Toledo, OH 43620-1643 |
Vin | 2C3CDYAG2CH170392 |
Phone | 419-704-3705 |
Name | ANDREW NEWBY |
---|---|
Car | JEEP GRAND CHEROKEE |
Year | 2012 |
Address | 1301 N Summit St, Toledo, OH 43604-1819 |
Vin | 1C4RJFAG2CC103426 |
Name | ANDREW NEWBY |
---|---|
Car | NISSAN MAX 3.5SV SEDAN |
Year | 2010 |
Address | 105 STRATFORD SQ, PORT ORANGE, FL 32127-5938 |
Vin | 1N4AA5AP2AC874608 |
Name | Andrew Newby |
---|---|
Domain | 1010aerials.com |
Contact Email | [email protected] |
Whois Sever | whois.schlund.info |
Create Date | 2012-06-01 |
Update Date | 2013-06-02 |
Registrar Name | 1 & 1 INTERNET AG |
Registrant Address | 10 Neptune Drive Bridlington YKS YO16 4EF |
Registrant Country | UNITED KINGDOM |
Name | Andrew Newby |
---|---|
Domain | greatlakesmediatorsandarbitrators.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-12-11 |
Update Date | 2012-12-11 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | cstsglobal.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-03-13 |
Update Date | 2012-03-13 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | buylocaldrinklocal.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-06-26 |
Update Date | 2013-06-26 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | buylocalcoffee.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-06-26 |
Update Date | 2013-06-26 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | drinklocalcoffee.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-06-26 |
Update Date | 2013-06-26 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | swimsportgear.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2009-10-04 |
Update Date | 2013-10-05 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | cedarwoodplaza.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2010-10-29 |
Update Date | 2013-10-30 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | mycilia.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2011-12-20 |
Update Date | 2011-12-20 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | jossnewby.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2009-07-09 |
Update Date | 2013-07-02 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | toledoblockwatch.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2011-11-02 |
Update Date | 2013-11-03 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
Registrant Country | UNITED STATES |
Name | ANDREW NEWBY |
---|---|
Domain | glinksmobile.com |
Contact Email | [email protected] |
Whois Sever | whois.enom.com |
Create Date | 2011-11-10 |
Update Date | 2013-11-11 |
Registrar Name | ENOM, INC. |
Registrant Address | 19 GASKYNS CLOSE RUDGWICK WEST SUSSEX RH123HE |
Registrant Country | UNITED KINGDOM |
Name | Andrew Newby |
---|---|
Domain | parkside-villa.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2010-10-29 |
Update Date | 2013-10-30 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | pleasantlakevilla.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2010-10-29 |
Update Date | 2013-10-30 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | nwosuppliers.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-10-30 |
Update Date | 2012-10-30 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | orchardvilla-toledo.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2010-10-29 |
Update Date | 2013-10-30 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | greatlakesmediators.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-12-11 |
Update Date | 2012-12-11 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | glmas.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-12-20 |
Update Date | 2013-02-08 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | anewby.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2008-09-26 |
Update Date | 2013-09-17 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 333 Galloway Dr Orleans Ontario K1E 1W2 |
Registrant Country | CANADA |
Name | Andrew Newby |
---|---|
Domain | completesafetytrainingservices.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-02-10 |
Update Date | 2013-02-11 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | northwestohiosolarhub.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2011-10-10 |
Update Date | 2013-10-11 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
Registrant Country | UNITED STATES |
Name | ANDREW NEWBY |
---|---|
Domain | 4templatesdatafeed.com |
Contact Email | [email protected] |
Whois Sever | whois.enom.com |
Create Date | 2010-03-12 |
Update Date | 2013-02-11 |
Registrar Name | ENOM, INC. |
Registrant Address | 19 GASKYNS CLOSE RUDGWICK WEST SUSSEX RH123HE |
Registrant Country | UNITED KINGDOM |
Name | Andrew Newby |
---|---|
Domain | bearingaccessories.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2013-08-09 |
Update Date | 2013-08-09 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43604 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | delphphotos.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2011-02-24 |
Update Date | 2013-02-25 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | tentenaerials.com |
Contact Email | [email protected] |
Whois Sever | whois.schlund.info |
Create Date | 2012-10-28 |
Update Date | 2013-10-29 |
Registrar Name | 1 & 1 INTERNET AG |
Registrant Address | 10 Neptune Drive Bridlington YKS YO16 4EF |
Registrant Country | UNITED KINGDOM |
Name | Andrew Newby |
---|---|
Domain | myseasontechwarranty.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2012-02-21 |
Update Date | 2012-02-21 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | 1301 North Summit Toledo Ohio 43615 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | ineedfasterbroadband.com |
Contact Email | [email protected] |
Whois Sever | whois.schlund.info |
Create Date | 2013-08-31 |
Update Date | 2013-08-31 |
Registrar Name | 1 & 1 INTERNET AG |
Registrant Address | 10 Neptune Drive Bridlington YKS YO16 4EF |
Registrant Country | UNITED KINGDOM |
Name | ANDREW NEWBY |
---|---|
Domain | rubber-passion.com |
Contact Email | [email protected] |
Whois Sever | whois.enom.com |
Create Date | 2007-04-22 |
Update Date | 2013-04-23 |
Registrar Name | ENOM, INC. |
Registrant Address | 4 SPALDING ROAD|BOURNE, PE10 9LE BOURNE PE10 9LE |
Registrant Country | UNITED KINGDOM |
Name | Andrew Newby |
---|---|
Domain | orchardvilla-oregon.com |
Contact Email | [email protected] |
Whois Sever | whois.godaddy.com |
Create Date | 2010-10-29 |
Update Date | 2013-10-30 |
Registrar Name | GODADDY.COM, LLC |
Registrant Address | c/o GoDaddy Redemption Services|14455 N. Hayden Road, Suite 219 Scottsdale AZ 85260 |
Registrant Country | UNITED STATES |
Name | Andrew Newby |
---|---|
Domain | satandiptv.com |
Contact Email | [email protected] |
Whois Sever | whois.schlund.info |
Create Date | 2013-07-02 |
Update Date | 2013-07-02 |
Registrar Name | 1 & 1 INTERNET AG |
Registrant Address | 10 Neptune Drive Bridlington YKS YO16 4EF |
Registrant Country | UNITED KINGDOM |