We have found 29 public records related to Robert Walsh in Illinois . Ethnicity of all people found is Irish. Education levels of people we have found are: Completed College and Completed Graduate School. All people found speak English language. There is 1 business registration records connected with Robert Walsh in public record. This business is registered in Illinois state. There are no industries specified in public records for the businesses we have found. There are 5 profiles of government employees in our database. Job titles of people found are: Engineer, Engineering Technician V and Correctional Officer. All people work in Illinois state. Average wage of employees is $87,640.
| Business Name | WALSH, ROBERT |
|---|---|
| Person Name | ROBERT WALSH |
| Position | company contact |
| State | IL |
| Address | 7620 w. coach rd, PALOS HEIGHTS, 60463 IL |
| [email protected] |
| State | IL |
|---|---|
| Calendar Year | 2016 |
| Employer | Department Of Corrections |
| Job Title | Correctional Officer |
| Name | Walsh Robert J |
| Annual Wage | $67,808 |
| State | IL |
|---|---|
| Calendar Year | 2015 |
| Employer | Metropolitan Water Reclamation District |
| Job Title | Engineering Technician V |
| Name | Walsh Robert |
| Annual Wage | $109,639 |
| State | IL |
|---|---|
| Calendar Year | 2015 |
| Employer | Fire Protection District Of Orland |
| Job Title | Engineer |
| Name | Walsh Robert M |
| Annual Wage | $119,648 |
| State | IL |
|---|---|
| Calendar Year | 2015 |
| Employer | Department Of Corrections |
| Job Title | Correctional Officer |
| Name | Walsh Robert J |
| Annual Wage | $65,516 |
| State | IL |
|---|---|
| Calendar Year | 2015 |
| Employer | Ambulatory And Community Hlth. Ntwk Of Cook County |
| Name | Walsh Robert |
| Annual Wage | $75,588 |
| Name | Robert E Walsh |
|---|---|
| Address | 1168 Taylor St Northbrook IL 60062 -7807 |
| Phone Number | 224-213-7305 |
| Gender | Male |
| Ethnicity | Irish |
| Ethnic Group | Western European |
| Estimated Household Income | $250,000 |
| Estimated Net Worth | $0 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 3001 |
| Education | Completed College |
| Language | English |
| Name | Robert S Walsh |
|---|---|
| Address | 27 S Greenview Ave Mundelein IL 60060 -2167 |
| Phone Number | 224-475-0333 |
| Gender | Male |
| Date Of Birth | 1956-02-17 |
| Ethnicity | Irish |
| Ethnic Group | Western European |
| Estimated Household Income | $45,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 3001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Robert E Walsh |
|---|---|
| Address | 1409 Heatherton Dr Naperville IL 60563 -2232 |
| Phone Number | 630-579-0092 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Irish |
| Ethnic Group | Western European |
| Estimated Household Income | $50,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 5001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Robert M Walsh |
|---|---|
| Address | 9645 Cook Ave Oak Lawn IL 60453 -3066 |
| Phone Number | 708-422-3727 |
| Mobile Phone | 708-557-5363 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1959-08-11 |
| Ethnicity | Irish |
| Ethnic Group | Western European |
| Estimated Household Income | $100,000 |
| Estimated Net Worth | $100,000 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 1001 |
| Education | Completed College |
| Language | English |
| Name | Robert C Walsh |
|---|---|
| Address | 6224 S Kostner Ave Chicago IL 60629 -5205 |
| Phone Number | 773-912-6450 |
| [email protected] | |
| Gender | Male |
| Ethnicity | Irish |
| Ethnic Group | Western European |
| Estimated Household Income | $55,000 |
| Estimated Net Worth | $250,000 |
| Lines Of Credit Trade Counter | 2 |
| Range Of New Credit | 1001 |
| Education | Completed Graduate School |
| Language | English |
| Name | Robert J Walsh |
|---|---|
| Address | 10014 Hope Dr Des Plaines IL 60018 -4308 |
| Phone Number | 847-825-4725 |
| [email protected] | |
| Gender | Male |
| Date Of Birth | 1933-06-10 |
| Ethnicity | Irish |
| Ethnic Group | Western European |
| Estimated Household Income | $15,000 |
| Estimated Net Worth | $0 |
| Lines Of Credit Trade Counter | 1 |
| Range Of New Credit | 3001 |
| Education | Completed College |
| Language | English |
| Name | ROBERT & LUCY S WALSH |
|---|---|
| Address | 239 Leonard Wood Highland Park IL 60035 |
| Value | 19307 |
| Landvalue | 19307 |
| Buildingvalue | 109977 |
| Name | ROBERT WALSH |
|---|---|
| Car | TOYOTA CAMRY |
| Year | 2007 |
| Address | 19898 E Lindenwood Rd, Lindenwood, IL 61049-9567 |
| Vin | 4T1BE46KX7U565980 |
| Phone | 815-393-4843 |
| Name | ROBERT WALSH |
|---|---|
| Car | MAZDA CX-7 |
| Year | 2007 |
| Address | 407 N Chicago Ave, Ladd, IL 61329-9624 |
| Vin | JM3ER293670111786 |
| Name | Robert Walsh |
|---|---|
| Domain | howtogrowplumeriafrangipanianytimeanywhere.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2010-08-16 |
| Update Date | 2013-08-17 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 315 Des Plaines AVE Forest Park IL 60130 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17083664581 |
| Name | Robert Walsh |
|---|---|
| Domain | robertwalshkidsclothing.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2007-06-21 |
| Update Date | 2013-06-22 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 315 Des Plaines AVE Forest Park IL 60130 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17083664581 |
| Name | Robert Walsh |
|---|---|
| Domain | gamble24hours.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2009-01-07 |
| Update Date | 2013-01-30 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 10708 s.Hamlin chicago Illinois 60655 |
| Registrant Country | UNITED STATES |
| Name | Robert Walsh |
|---|---|
| Domain | mufflerz.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2007-05-20 |
| Update Date | 2013-06-05 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 10708 s.Hamlin chicago Illinois 60655 |
| Registrant Country | UNITED STATES |
| Name | Robert Walsh |
|---|---|
| Domain | irishmeselfluck.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2008-03-05 |
| Update Date | 2013-03-30 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 10708 s.Hamlin chicago Illinois 60655 |
| Registrant Country | UNITED STATES |
| Name | Robert Walsh |
|---|---|
| Domain | 7j11.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2007-11-03 |
| Update Date | 2013-11-04 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 10708 s.Hamlin chicago Illinois 60655 |
| Registrant Country | UNITED STATES |
| Name | Robert Walsh |
|---|---|
| Domain | 7l11.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2007-11-03 |
| Update Date | 2013-11-04 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 10708 s.Hamlin chicago Illinois 60655 |
| Registrant Country | UNITED STATES |
| Name | Robert Walsh |
|---|---|
| Domain | 7z11.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2007-11-03 |
| Update Date | 2013-11-04 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 10708 s.Hamlin chicago Illinois 60655 |
| Registrant Country | UNITED STATES |
| Name | Robert Walsh |
|---|---|
| Domain | freepick3strategy.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2010-03-10 |
| Update Date | 2013-03-11 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 315 Des Plaines AVE Forest Park IL 60130 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17083664581 |
| Name | Robert Walsh |
|---|---|
| Domain | crk4oal93qsy51qrsm.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2010-01-09 |
| Update Date | 2013-01-10 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 315 Des Plaines AVE Forest Park IL 60130 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17083664581 |
| Name | Robert Walsh |
|---|---|
| Domain | freevideoshowtowinthelotterynumberspick34.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2010-04-30 |
| Update Date | 2013-05-01 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 315 Des Plaines AVE Forest Park IL 60130 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17083664581 |
| Name | Robert Walsh |
|---|---|
| Domain | 7w11.com |
| Contact Email | [email protected] |
| Whois Sever | whois.godaddy.com |
| Create Date | 2007-11-03 |
| Update Date | 2013-11-04 |
| Registrar Name | GODADDY.COM, LLC |
| Registrant Address | 10708 s.Hamlin chicago Illinois 60655 |
| Registrant Country | UNITED STATES |
| Name | Robert Walsh |
|---|---|
| Domain | winningpick4lotterysystem.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2013-07-20 |
| Update Date | 2013-07-20 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 315 Des Plaines AVE Forest Park IL 60130 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17083664581 |
| Name | Robert Walsh |
|---|---|
| Domain | pickthreestrategy.com |
| Contact Email | [email protected] |
| Whois Sever | whois.schlund.info |
| Create Date | 2010-03-10 |
| Update Date | 2013-03-11 |
| Registrar Name | 1 & 1 INTERNET AG |
| Registrant Address | 315 Des Plaines AVE Forest Park IL 60130 |
| Registrant Country | UNITED STATES |
| Registrant Fax | 17083664581 |